DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fzr and CDC20B

DIOPT Version :9

Sequence 1:NP_524852.2 Gene:fzr / 45922 FlyBaseID:FBgn0262699 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_001163873.1 Gene:CDC20B / 166979 HGNCID:24222 Length:519 Species:Homo sapiens


Alignment Length:484 Identity:154/484 - (31%)
Similarity:231/484 - (47%) Gaps:83/484 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 YNNWQTNFA---SINKSNDNSPQTSK-KQRDCGETARDSLA--YSCLLKNELLGSAIDDVKTAGE 101
            |:::::|||   |......:||.|:: :|......:.||..  .|.....|..||.:   ||..|
Human    51 YSDFKSNFAKRLSAEVPVASSPITTRWQQSQTRALSSDSFGEEQSTTYLPEASGSVL---KTPPE 112

  Fly   102 E-------RNENAYTPA------AKRSLFKYQSPTKQDYNGECPYSLSPVSAKSQKLLRS----- 148
            :       |.|...||:      :..:|...::|...|.:.:     ..|::|.||.|:.     
Human   113 KETLTLGSRKEQLKTPSKGISETSNSALHFCKAPHAMDRDWK-----ESVASKGQKCLKQLFVTQ 172

  Fly   149 --PRKATRKI-----SRIPFK-----VLD----------------APE-------LQDDFYLNLV 178
              .::|..|:     |...:|     |.|                .||       |::|:|||::
Human   173 NVVQQANGKMQLCEQSECVWKGCKDGVRDESFHLKSSGDINDSILQPEVKIHITGLRNDYYLNIL 237

  Fly   179 DWSSQNVLAVGLGSCVYLWSACTSQVTRLCDLSPDANTVTSVSWNERGNTVAVGTHHGYVTVWDV 243
            |||.||::|:.|||.||:|:..........|||...|.::||||.:.|..:||||..|.|.:|||
Human   238 DWSFQNLVAIALGSAVYIWNGENHNGIENIDLSLTCNYISSVSWIKEGTCLAVGTSEGEVQLWDV 302

  Fly   244 AANKQINKLNGHSARVGALAWNSDILSSGSRDRWIIQRDTRTPQLQSERRLAG---HRQEVCGLK 305
            ...|::..:.||.:.||||:||..|||||||...:...|.|..|     ...|   |:|.||.||
Human   303 VTKKRLRNMLGHLSVVGALSWNHFILSSGSRLGRVYHHDVRVAQ-----HHVGTLRHKQAVCALK 362

  Fly   306 WSPDNQYLASGGNDNRLYVWNQHSV------NPVQSYTEHMAAVKAIAWSPHHHGLLASGGGTAD 364
            ||||.:.|:||.:|..|.:| .|..      .|::..|: ..||||:.|.|...|:||.|||..|
Human   363 WSPDGRLLSSGCSDGLLTIW-PHDPGASAQGQPLKVITQ-STAVKAMDWCPWQSGVLAIGGGMKD 425

  Fly   365 RCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQILVWKYPSLTQVAKLTGHSY 429
            ..:...:...|:.:|...|.||:|:|.|...:.|:.:..|..:|.:.||..|::::.....||..
Human   426 GRLHILDINAGKSIQTPSTNSQICSLIWLPKTKEIATGQGTPKNDVTVWTCPTVSRSGGFFGHRG 490

  Fly   430 RVLYLALSPDGEAIVTGAGDETLRFWNVF 458
            |||:|:||||...:.:.|.|.|...||.:
Human   491 RVLHLSLSPDQTRVFSAAADGTASVWNCY 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzrNP_524852.2 WD40 <174..469 CDD:225201 114/294 (39%)
WD40 178..456 CDD:238121 109/286 (38%)
WD40 repeat 217..254 CDD:293791 15/36 (42%)
WD40 repeat 260..296 CDD:293791 15/35 (43%)
WD40 repeat 301..337 CDD:293791 16/41 (39%)
WD40 repeat 344..382 CDD:293791 13/37 (35%)
WD40 repeat 387..425 CDD:293791 9/37 (24%)
WD40 repeat 431..457 CDD:293791 11/25 (44%)
CDC20BNP_001163873.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..133 14/56 (25%)
WD 1 229..266 16/36 (44%)
WD40 <230..518 CDD:225201 114/294 (39%)
WD40 repeat 235..271 CDD:293791 15/35 (43%)
WD 2 271..310 16/38 (42%)
WD40 276..517 CDD:295369 93/247 (38%)
WD40 repeat 276..313 CDD:293791 15/36 (42%)
WD 3 311..341 15/29 (52%)
WD40 repeat 319..350 CDD:293791 15/35 (43%)
WD 4 353..392 17/39 (44%)
WD40 repeat 358..399 CDD:293791 16/41 (39%)
WD 5 399..441 15/42 (36%)
WD40 repeat 405..443 CDD:293791 13/37 (35%)
WD 6 443..484 12/40 (30%)
WD40 repeat 448..486 CDD:293791 9/37 (24%)
WD 7 487..519 15/31 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0305
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1220675at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.