DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ort and NtR

DIOPT Version :9

Sequence 1:NP_524406.1 Gene:ort / 45910 FlyBaseID:FBgn0003011 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster


Alignment Length:339 Identity:66/339 - (19%)
Similarity:130/339 - (38%) Gaps:107/339 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VYFHVTVMGLDSIDENSMTYVADVFFAQTWKDHRLRLPENMTQEYRLLEVDWLKNMWRPDSF--- 116
            :.||.....| :.::.|......:.....|:|.||                    :|:|:.|   
  Fly   239 ISFHFQTRSL-AYEQTSSLLQTRMHMMMHWRDSRL--------------------VWKPEDFGSL 282

  Fly   117 -------------FKNAKSVTFQTM--TIPNHYMWLYKDKTI-LYMVKLTLKLSCIMNFAIYPHD 165
                         ..|..:...|:|  .:.::.:.:|.:.:| ||...|.|...|:.:...:|.:
  Fly   283 ESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSE 347

  Fly   166 TQECKLQM--------ESLSHTTDDLIFQWDPTTPLVVDENIELP--------QVALIRNETADC 214
            ...|.:::        |:::     ||:. |...|:..:|::..|        .|.|:.|   |.
  Fly   348 RVTCDIELGLNGQEGQENVA-----LIYD-DQRKPIAPNEHVNTPSGWSFTQMSVVLVEN---DS 403

  Fly   215 TQVYS--------TGNFTCLEVVFTLKRRLVYYVFNTYIP--TC-MIVIMSWVSFWIKPEAAPAR 268
            .:.|:        ||:   :.:.|||:|...:|:...|:|  .| |.:|:|:|.      .:..|
  Fly   404 QRRYNPKGMMQKMTGD---VAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVL------RSTRR 459

  Fly   269 VTLGVTSLLTLS------TQHAKSQSSLPPVSYLKAVDAFMSVCTVFVFMALMEYCLINIVLSDT 327
            .:|.:.:||..:      |::| |...:||:     :.|:..:.....:..::..|:|.:.|   
  Fly   460 SSLILIALLIAAWGLMYMTRYA-SPHYVPPM-----MTAYKVIMMTTTYCYILHICIIWLDL--- 515

  Fly   328 PIPKPMAYPPKPVA 341
                   |||:..|
  Fly   516 -------YPPRSKA 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ortNP_524406.1 LIC 31..481 CDD:273305 66/339 (19%)
Neur_chan_LBD 38..235 CDD:280998 40/222 (18%)
Neur_chan_memb 243..>334 CDD:280999 20/99 (20%)
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 40/222 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.