DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ort and lgc-43

DIOPT Version :9

Sequence 1:NP_524406.1 Gene:ort / 45910 FlyBaseID:FBgn0003011 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001023062.1 Gene:lgc-43 / 259591 WormBaseID:WBGene00008076 Length:679 Species:Caenorhabditis elegans


Alignment Length:253 Identity:72/253 - (28%)
Similarity:135/253 - (53%) Gaps:5/253 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LDSIDENSMTYVADVFFAQTWKDHRLRLPENMTQEYRLLEVDWLKNMWRPDSFFKNAKSVTFQTM 128
            |.:.|...|.:..||....:|.|  :||..|.|:..|:.|...::.:||||.:..|:|...|..:
 Worm   355 LANFDSEMMEFSMDVEMEFSWID--IRLVNNYTKPIRIREKPIIEQIWRPDPYIVNSKHSYFHYV 417

  Fly   129 TIPNHYMWLYKDKTILYMVKLTLKLSCIMNFAIYPHDTQECKLQMESLSHTTDDLIFQWDPTTPL 193
            :.||..|.:..:..:.|.|:::...||.|:|.:||||.|||.|::.|::::...:.|.|. :.|:
 Worm   418 SFPNIRMRITPEGLVTYTVRVSSVCSCFMSFCLYPHDRQECDLRISSIAYSNQYVKFHWH-SNPI 481

  Fly   194 VVDENIELPQVALIRNETADCTQVYSTGNFTCLEVVFTLKRRLVYYVFNTYIPTCMIVIMSWVSF 258
            .....|.||::.:.:.:||:|:......:.:||.::|:|:|....:|...|:|:.:.::.:||:.
 Worm   482 KFQSKITLPELHITKIKTAECSTKGKLVDASCLRIIFSLERDSARFVIEKYVPSTLAMMFAWVAP 546

  Fly   259 WIKPEAAPARVTLGVTSLLTLSTQHAKSQSSLPPVSYLKAVDAFMSVCTVFVFMALME 316
            ::.......|:...:|.|||| .|..|....: ..|||.::|.:.:....|..::|:|
 Worm   547 YVPYNYEDVRIITPITVLLTL-VQMEKGDKEI-RTSYLTSIDVWFAAMKSFTVLSLLE 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ortNP_524406.1 LIC 31..481 CDD:273305 72/253 (28%)
Neur_chan_LBD 38..235 CDD:280998 51/170 (30%)
Neur_chan_memb 243..>334 CDD:280999 19/74 (26%)
lgc-43NP_001023062.1 LGIC_ECD_anion 344..523 CDD:349788 51/170 (30%)
LGIC_TM 527..665 CDD:365787 20/78 (26%)
TM1 helix 527..551 CDD:349850 5/23 (22%)
TM2 helix 555..577 CDD:349850 8/22 (36%)
TM3 helix 583..609 CDD:349850 4/20 (20%)
TM4 helix 610..665 CDD:349850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D614790at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18945
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.