DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ort and GABRG1

DIOPT Version :9

Sequence 1:NP_524406.1 Gene:ort / 45910 FlyBaseID:FBgn0003011 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_775807.2 Gene:GABRG1 / 2565 HGNCID:4086 Length:465 Species:Homo sapiens


Alignment Length:479 Identity:137/479 - (28%)
Similarity:214/479 - (44%) Gaps:99/479 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITDILPEDIKRYDKMRPPKKEGQPTIVYFHVTVMGLDSIDENSMTYVADVFFAQTWKDHRLRLPE 93
            ||.||...::.||....|....:||::...|.|..:..:|..:|.|..|:.|||||.|.||:.  
Human    64 ITQILNSLLQGYDNKLRPDIGVRPTVIETDVYVNSIGPVDPINMEYTIDIIFAQTWFDSRLKF-- 126

  Fly    94 NMTQEYRLLEVDWLKNMWRPDSFFKNAKSVTFQTMTIPNHYMWLYKDKTILYMVKLTLKLSCIMN 158
            |.|.:..:|..:.:..:|.||:||:|::......:|.||..:.::.|..:||.::||:...|.:.
Human   127 NSTMKVLMLNSNMVGKIWIPDTFFRNSRKSDAHWITTPNRLLRIWNDGRVLYTLRLTINAECYLQ 191

  Fly   159 FAIYPHDTQECKLQMESLSHTTDDLIFQWDPTTPLVVDENI-ELPQVALI--RNETADCTQVYST 220
            ...:|.|...|.|:..|..:..:::.::|...:..|.|... .|.|.|.:  ||.| :.|...| 
Human   192 LHNFPMDEHSCPLEFSSYGYPKNEIEYKWKKPSVEVADPKYWRLYQFAFVGLRNST-EITHTIS- 254

  Fly   221 GNFTCLEVVFTLKRRLVYYVFNTYIPTCMIVIMSWVSFWIKPEAAPARVTLGVTSLLTLSTQHAK 285
            |::..:.:.|.|.||:.|:...||||..:.|::|||||||..:|.|||.:||:|::||::|....
Human   255 GDYVIMTIFFDLSRRMGYFTIQTYIPCILTVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTI 319

  Fly   286 SQSSLPPVSYLKAVDAFMSVCTVFVFMALMEYCLINIVLSDTPIPKPMAYPPKPVAGDGPKKEGE 350
            ::.|||.|||:.|:|.|:|||.:|||.|||||..::...|:        ...|....|...|...
Human   320 ARKSLPKVSYVTAMDLFVSVCFIFVFAALMEYGTLHYFTSN--------QKGKTATKDRKLKNKA 376

  Fly   351 GAPPG---GSNSTASKQQATMLPLADEKIEKIEK----------------IFDEMTKNRRIVTTT 396
            ...||   ||         |::|:.:..:.:.:.                .|::.          
Human   377 SMTPGLHPGS---------TLIPMNNISVPQEDDYGYQCLEGKDCASFFCCFEDC---------- 422

  Fly   397 RRVVRPPLDADGPWIPRQESRIILTPTIAPPPPPPQPAAPEPELPKPKLTPAQERLKRAIYIDRS 461
                     ..|.|   :|.||.:                                 |...||..
Human   423 ---------RTGSW---REGRIHI---------------------------------RIAKIDSY 442

  Fly   462 SRVLFPALFASLNGIYWCVFYEYL 485
            ||:.||..||..|.:|| |.|.||
Human   443 SRIFFPTAFALFNLVYW-VGYLYL 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ortNP_524406.1 LIC 31..481 CDD:273305 131/471 (28%)
Neur_chan_LBD 38..235 CDD:280998 56/199 (28%)
Neur_chan_memb 243..>334 CDD:280999 43/90 (48%)
GABRG1NP_775807.2 LIC 66..462 CDD:273305 132/472 (28%)
LGIC_ECD_GABAAR_G 88..269 CDD:349801 52/184 (28%)
Cys-loop 188..202 CDD:349801 3/13 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.