DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ort and lgc-35

DIOPT Version :9

Sequence 1:NP_524406.1 Gene:ort / 45910 FlyBaseID:FBgn0003011 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001022438.1 Gene:lgc-35 / 189960 WormBaseID:WBGene00012915 Length:515 Species:Caenorhabditis elegans


Alignment Length:314 Identity:87/314 - (27%)
Similarity:154/314 - (49%) Gaps:37/314 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RYDKMRPPKK--EGQPTIVYFHVTVMGLDSIDENSMTYVADVFFAQTWKDHRLRLP----ENMTQ 97
            :||..:.|..  :| |..|...:.|..:.|:.|.:|.|..::|:.::|:|.||...    :|.| 
 Worm    83 KYDHRQVPDDGYDG-PVHVNVSIVVSNIRSVSEVTMDYSIEMFYRESWRDPRLTYSRDKFKNKT- 145

  Fly    98 EYRLLEVDWLKNMWRPDSFFKNA--------KSVTFQTMTIPNHYMWLYKDKTILYMVKLTLKLS 154
            |..|.| .:...:|.||:|..||        :|:|.:::      :.|..:.:|||..:|:|.|:
 Worm   146 EISLHE-SYSNYLWHPDTFVPNAISSKNPRRQSITHRSL------LRLRNNGSILYSRRLSLILT 203

  Fly   155 CIMNFAIYPHDTQECKLQMESLSHTTDDLIFQWDPTTPLVVD---ENIELPQVALIRNETADCTQ 216
            |.|:..::|.|||.||:..||..:|.|.:.:.|  :|..:..   ..|.||...:.........:
 Worm   204 CGMDLTLFPFDTQLCKMGFESYGYTADKVKYLW--STGAIQSLKLHKIRLPDFQVKEAYVTSRVE 266

  Fly   217 VYSTGNFTCLEVVFTLKRRLVYYVFNTYIPTCMIVIMSWVSFWIKPEAAPARVTLGVTSLLTLST 281
            .|:||:::.|.|.|...|...:......||:..:||.||||.|::.|.:...:   ::.:||::.
 Worm   267 SYATGDYSRLYVCFVFNRAAGFCFLQLIIPSTAVVITSWVSLWMENETSFQDM---ISIILTITF 328

  Fly   282 QHAKSQSSLPPVSYLKAVDAFMSVCTVFVFMALMEYCLIN------IVLSDTPI 329
            ........:|.|||:||:|.::.||...||::|::...:.      ::..||.|
 Worm   329 LLFSYNEVMPRVSYIKAMDVYLGVCFCIVFLSLIKLAAVKYMRQRLLITRDTSI 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ortNP_524406.1 LIC 31..481 CDD:273305 87/314 (28%)
Neur_chan_LBD 38..235 CDD:280998 59/212 (28%)
Neur_chan_memb 243..>334 CDD:280999 27/93 (29%)
lgc-35NP_001022438.1 LIC 83..491 CDD:273305 87/314 (28%)
Neur_chan_LBD 84..283 CDD:280998 59/209 (28%)
Neur_chan_memb 293..>370 CDD:280999 24/79 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.