DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ort and avr-14

DIOPT Version :9

Sequence 1:NP_524406.1 Gene:ort / 45910 FlyBaseID:FBgn0003011 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001020963.1 Gene:avr-14 / 172270 WormBaseID:WBGene00000232 Length:430 Species:Caenorhabditis elegans


Alignment Length:334 Identity:121/334 - (36%)
Similarity:185/334 - (55%) Gaps:23/334 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILVICTICMKHYAKGEFQQSLAITDILPEDIKRYD-KMRPP------KKEGQPTIVYFHVTVMGL 64
            ||:|.:|.....||.:.::.    :|:...:|.|| ::||.      ...|.|.:|..::.:..:
 Worm     9 ILLIISIIHSIRAKRKLKEQ----EIIQRILKDYDWRVRPRGMNATWPDTGGPVLVTVNIYLRSI 69

  Fly    65 DSIDENSMTYVADVFFAQTWKDHRL---RLPENMTQEYRLLEV-------DWLKNMWRPDSFFKN 119
            ..||:.:|.|.|...|.:.|.|.||   |..|:...|.....|       |..:.:|.||:||:|
 Worm    70 SKIDDVNMEYSAQFTFREEWTDQRLAYERYEESGDTEVPPFVVLATSENADQSQQIWMPDTFFQN 134

  Fly   120 AKSVTFQTMTIPNHYMWLYKDKTILYMVKLTLKLSCIMNFAIYPHDTQECKLQMESLSHTTDDLI 184
            .|......:..||..:.::|:..|||.|:|:|.|||.|:...||.|.|.|.:.:.|.::||.|:.
 Worm   135 EKEARRHLIDKPNVLIRIHKNGQILYSVRLSLVLSCPMSLEFYPLDRQNCLIDLASYAYTTQDIK 199

  Fly   185 FQWDPTTPLVVDENI--ELPQVALIRNETADCTQVYSTGNFTCLEVVFTLKRRLVYYVFNTYIPT 247
            ::|....|:...:.:  .||...|....|..||.:.:||.::|..||..|:|...||:...|||.
 Worm   200 YEWKEKKPIQQKDGLRQSLPSFELQDVVTDYCTSLTNTGEYSCARVVLRLRREYSYYLIQLYIPC 264

  Fly   248 CMIVIMSWVSFWIKPEAAPARVTLGVTSLLTLSTQHAKSQSSLPPVSYLKAVDAFMSVCTVFVFM 312
            .|:|::||||||:..:|.||||:||||:|||::||.:...|.||||||:||||.::.||..|:|.
 Worm   265 IMLVVVSWVSFWLDKDAVPARVSLGVTTLLTMTTQASGINSKLPPVSYIKAVDVWIGVCLAFIFG 329

  Fly   313 ALMEYCLIN 321
            ||:||.::|
 Worm   330 ALLEYAVVN 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ortNP_524406.1 LIC 31..481 CDD:273305 115/310 (37%)
Neur_chan_LBD 38..235 CDD:280998 66/215 (31%)
Neur_chan_memb 243..>334 CDD:280999 45/79 (57%)
avr-14NP_001020963.1 LIC 20..424 CDD:273305 117/323 (36%)
Neur_chan_LBD 27..253 CDD:280998 68/229 (30%)
Neur_chan_memb 260..>355 CDD:280999 45/79 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45222
OrthoDB 1 1.010 - - D276914at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18945
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.