DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpinb6c

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001369781.1 Gene:Serpinb6c / 97848 MGIID:2145481 Length:379 Species:Mus musculus


Alignment Length:389 Identity:106/389 - (27%)
Similarity:189/389 - (48%) Gaps:32/389 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PVFSYMDRFSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMA- 165
            |:......|:..|.| |:.....:||..||.|:.:.|.::...:.|.|..::.:|....|.:.: 
Mouse     4 PLLEANATFALNLLK-ILGEDRSKNVFLSPISISSALVMVLLGAKGTTAIQITQALSLGKCSSSE 67

  Fly   166 ---VAQDFESVIKYKKHLEGADLTLATKVYYNRELGGVNHSYDEYAKF------YFSAGTEAVDM 221
               |.|.|:.::. :.:..|...:|...   ||..|  ..::|..|.|      ::.|..|.:|.
Mouse    68 DGDVHQGFQLLLS-EVNKTGTQYSLKAA---NRLFG--EKTFDILASFKDSCHKFYEAEMEELDF 126

  Fly   222 QNAKDTAAK-INAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQ 285
            :.|.:.:.: ||.||...|.:||::|::|..:...|..:|||||||:|:||.:|...||....|:
Mouse   127 KGATEQSRQHINTWVAKKTEDKIKELLSPGTIHSNTPLILVNAVYFKGKWEKQFNKEDTREMPFK 191

  Fly   286 HTNGRISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLSRPEF 350
            .:......|.|||....:.:..:.|:....|.|.|..:..:|:|:||:|...|..:.::::..:|
Mouse   192 VSKNEEKPVQMMFQKSTFKMTYVEEISTKILLLPYVGNELNMIIMLPDEHVELSTVEKEITHEKF 256

  Fly   351 -DLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPN----SQVTKLMDQPVRVSK 410
             :..|: .|::.:.|.|.||.|:.|...||.:.|..||:...|...    |.::.  .|.:.:|.
Mouse   257 IEWTRL-DRMKGEKVEVFLPWFKLEENYDMKDVLCKLGMTDAFEEGRADFSGISS--KQGLFLSN 318

  Fly   411 ILQKAYINVGEAGTEASAASYAKFVPLSLPPKPTE-FVANRPFVFAVR--TPASVLFIGHVEYP 471
            ::.|:.:.|.|.|:||:||:   .:.|....:.|. |..||||:|.::  ....:||:|.:..|
Mouse   319 VIHKSVVEVNEEGSEATAAT---TIVLKGSSRSTPCFCVNRPFIFFIQHIKTNEILFLGRLSSP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 104/378 (28%)
Serpinb6cNP_001369781.1 serpin 2..379 CDD:422956 105/387 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.