DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and SERPINB7

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001035237.1 Gene:SERPINB7 / 8710 HGNCID:13902 Length:380 Species:Homo sapiens


Alignment Length:399 Identity:114/399 - (28%)
Similarity:180/399 - (45%) Gaps:66/399 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 FSSELFKEIIKSQSQQNVVFSPFSVHALLALI-YGASDGKTFRELQKA---------GEFSKNAM 164
            |...||:|:..:|...||.||..|:.|.|||: .||.| .:..::.|.         |..|.:..
Human    11 FCFNLFREMDDNQGNGNVFFSSLSLFAALALVRLGAQD-DSLSQIDKLLHVNTASGYGNSSNSQS 74

  Fly   165 AVAQDFESVI-----KYKKHLEGADLTL-----ATKVYYNRELGGVNHSYDEYAKFYFSAGTEAV 219
            .:....:.|.     .:|.:    ||::     |.|||      |.:..|.|.|:..:.|..|.|
Human    75 GLQSQLKRVFSDINASHKDY----DLSIVNGLFAEKVY------GFHKDYIECAEKLYDAKVERV 129

  Fly   220 DMQN-AKDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYD 283
            |..| .:||...||.||.:.|..||::::....:......:|||||||:|:|:..|...:|....
Human   130 DFTNHLEDTRRNINKWVENETHGKIKNVIGEGGISSSAVMVLVNAVYFKGKWQSAFTKSETINCH 194

  Fly   284 FQHTNGRISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLSRP 348
            |:........||||..:..:.|:.:.:.....|||.| :...:|.:||                |
Human   195 FKSPKCSGKAVAMMHQERKFNLSVIEDPSMKILELRY-NGGINMYVLL----------------P 242

  Fly   349 EFDLNRVAHRLRRQS--------------VAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVT 399
            |.||:.:.::|..|:              |.|..|:|:.|...:|.:.|:.||:..:|..:....
Human   243 ENDLSEIENKLTFQNLMEWTNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIFDESKADL 307

  Fly   400 KLMDQPVR--VSKILQKAYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAVRTPASV 462
            ..:....|  :|:::.|:||.|.|.||||:||:.:..|...| |:.|.|.|:.||:|.:|....:
Human   308 SGIASGGRLYISRMMHKSYIEVTEEGTEATAATGSNIVEKQL-PQSTLFRADHPFLFVIRKDDII 371

  Fly   463 LFIGHVEYP 471
            ||.|.|..|
Human   372 LFSGKVSCP 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 112/394 (28%)
SERPINB7NP_001035237.1 serpinB7_megsin 1..380 CDD:381032 113/397 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.