DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and SRP3

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_176586.1 Gene:SRP3 / 842706 AraportID:AT1G64030 Length:385 Species:Arabidopsis thaliana


Alignment Length:409 Identity:104/409 - (25%)
Similarity:170/409 - (41%) Gaps:92/409 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 KEIIKSQS----------------QQNVVFSPFSVHALLALIYGASDG----------------- 147
            :|.:|:|:                ..||:|||.|:::.:.: :.|..|                 
plant     4 REAMKNQTHVAMILSGHVLSSAPKDSNVIFSPASINSAITM-HAAGPGGDLVSGQILSFLRSSSI 67

  Fly   148 ---KT-FRELQKAGEFSKNAMAVAQDFESVIKYKKHLEGADLTLATKVYYNRELGGVNHSYDEYA 208
               || ||||.......::|..                |..:|.|..::.::.| ..:..:.:..
plant    68 DELKTVFRELASVVYADRSATG----------------GPKITAANGLWIDKSL-PTDPKFKDLF 115

  Fly   209 KFYFSAGTEAVDMQN-AKDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEH 272
            :.:|.|....||.:: |::...::|:||...|.|.|:||:....|...|..:..||:.|:|.|:.
plant   116 ENFFKAVYVPVDFRSEAEEVRKEVNSWVEHHTNNLIKDLLPDGSVTSLTNKIYANALSFKGAWKR 180

  Fly   273 EFATMDTSPYDFQHTNGRISKVAMMFN-DDVYGLAELPELGATALELAYKDSAT------SMLIL 330
            .|....|...||...||....|..|.: ::.|..|   ..|...|.|.|:..:.      ||...
plant   181 PFEKYYTRDNDFYLVNGTSVSVPFMSSYENQYVRA---YDGFKVLRLPYQRGSDDTNRKFSMYFY 242

  Fly   331 LPNETTGLGKMLQQL-SRPEFDLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTP 394
            ||::..||..:|::: |.|.| |:......|.:....|:|||:.||...:|..|..||:..|   
plant   243 LPDKKDGLDDLLEKMASTPGF-LDSHIPTYRDELEKFRIPKFKIEFGFSVTSVLDRLGLRSM--- 303

  Fly   395 NSQVTKLMDQPVRVSKILQKAYINVGEAGTEASAASYAKFVPLSL----PPKPTEFVANRPFVFA 455
                           .:..||.:.:.|.|.||:||:.......||    |||..:|||:.||:|.
plant   304 ---------------SMYHKACVEIDEEGAEAAAATADGDCGCSLDFVEPPKKIDFVADHPFLFL 353

  Fly   456 VR--TPASVLFIGHVEYPT 472
            :|  ...:|||:|.:..|:
plant   354 IREEKTGTVLFVGQIFDPS 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 103/403 (26%)
SRP3NP_176586.1 serpinP_plants 8..371 CDD:381001 102/402 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.