DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and AT3G45220

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_190108.1 Gene:AT3G45220 / 823658 AraportID:AT3G45220 Length:393 Species:Arabidopsis thaliana


Alignment Length:393 Identity:115/393 - (29%)
Similarity:187/393 - (47%) Gaps:52/393 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 LFKEIIKSQSQ-QNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVAQDFESVIKYK 177
            |.|.:|.:.:. .|:||||.|::.||.||...|:..|..::...      .|..:.|:.:.:..|
plant    17 LAKHVIPTVANGSNLVFSPMSINVLLCLIAAGSNCVTKEQILSF------IMLPSSDYLNAVLAK 75

  Fly   178 -------KHLEGADLTLATK--VYYNRELGGVNHSYDEYAKFYFSAGTEAVDM-QNAKDTAAKIN 232
                   ..:|.:||.|:|.  |:.::.| ....|:.:..:..::|....||. ....:...::|
plant    76 TVSVALNDGMERSDLHLSTAYGVWIDKSL-SFKPSFKDLLENSYNATCNQVDFATKPAEVINEVN 139

  Fly   233 AWVMDTTRNKIRDLVTPTDVDP--QTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGRISKVA 295
            ||....|...|:::::...:..  ::..:|.|||||:|.|..:|....|..|||...:|.:.||.
plant   140 AWAEVHTNGLIKEILSDDSIKTIRESMLILANAVYFKGAWSKKFDAKLTKSYDFHLLDGTMVKVP 204

  Fly   296 MMFND-----DVYGLAELPELGATALELAYKDSAT--SMLILLPNETTGLGKMLQQL-SRPEFDL 352
            .|.|.     :.|.       |...|.|.|.:...  :|.|.|||:..||..:|::: |:|.|..
plant   205 FMTNYKKQYLEYYD-------GFKVLRLPYVEDQRQFAMYIYLPNDRDGLPTLLEEISSKPRFLD 262

  Fly   353 NRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLMDQP-----------V 406
            |.:. |.|..:.|.::|||:|.||...::.||.:|:...||..| :|::::.|           :
plant   263 NHIP-RQRILTEAFKIPKFKFSFEFKASDVLKEMGLTLPFTHGS-LTEMVESPSIPENLCVAENL 325

  Fly   407 RVSKILQKAYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAVRTPAS--VLFIGHVE 469
            .||.:..||.|.|.|.||||:|.|.|......|  ...:|||:.||:|.||...|  :||:|.|.
plant   326 FVSNVFHKACIEVDEEGTEAAAVSVASMTKDML--LMGDFVADHPFLFTVREEKSGVILFMGQVL 388

  Fly   470 YPT 472
            .|:
plant   389 DPS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 113/387 (29%)
AT3G45220NP_190108.1 plant_SERPIN 8..390 CDD:238998 114/390 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.