DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpine3

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_006252257.2 Gene:Serpine3 / 691375 RGDID:1585042 Length:413 Species:Rattus norvegicus


Alignment Length:368 Identity:85/368 - (23%)
Similarity:155/368 - (42%) Gaps:38/368 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 FSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVAQDFESV- 173
            |:..|::......:..|.|.||.||...|.::..|:.|.|..:|.:|..::.....|.:...:| 
  Rat    35 FALHLYQSAAAETNGTNFVISPASVSLSLEILQFAARGNTGWQLAEALGYTVQDPRVREFLHTVY 99

  Fly   174 IKYKKHLEGADLTLATKVYYNRELG-GVNHSYDEYAKFYFSAGTEAVDMQNAKDTAAKINAWVMD 237
            |......:|..:.||..::  .:.| .::..:.|....:.::..|..|.       ::.|...|:
  Rat   100 ITLHNSSQGIGMELACTLF--MQTGTSLSPCFVEQVSRWANSSLELADF-------SEPNTTTME 155

  Fly   238 TTRNKIRDLVTPTDVDP--------QTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGRISKV 294
            .::...|.........|        .||..:|:.:.||..|:..|:::...|..|...:|.:.:|
  Rat   156 ASKGTTRPSTGEGPGSPLWGRAGALSTQLSIVSTMTFQSSWQQRFSSVALQPLPFTCAHGLVLQV 220

  Fly   295 AMMFNDDVYGLAELPELG---ATALELAYKDSATSMLILLPNET-TGLGKMLQQLSRPEFDLNRV 355
            ..|.........:..:..   ...|||.|.....|:|::||.:. |.|..:...|:.      ||
  Rat   221 PAMHQVAEVSYGQFQDAAGHKVDVLELLYLGRVASLLLVLPQDKGTPLDHIEPHLTA------RV 279

  Fly   356 AH----RLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLMD--QPVRVSKILQK 414
            .|    ||:|..:.|.||:|:.:.:.|:...|::.|:..:|.|.....|.:.  ....||::..|
  Rat   280 IHLWTTRLKRARMDVFLPRFRIQNQFDLKSILRSWGITDLFDPLKANLKGISGRDGFYVSEVTHK 344

  Fly   415 AYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAVR 457
            |.:.:.|.||::.||:....:..|..|   .|.|:|||:|.:|
  Rat   345 AKMELSEEGTKSCAATAVLLLRRSRTP---AFKADRPFIFLLR 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 85/368 (23%)
Serpine3XP_006252257.2 serpin 20..400 CDD:422956 85/368 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.