DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpina1f

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_080963.2 Gene:Serpina1f / 68348 MGIID:1915598 Length:411 Species:Mus musculus


Alignment Length:409 Identity:87/409 - (21%)
Similarity:177/409 - (43%) Gaps:37/409 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 VVAVDLTKREPVTPPPNRPP----PVFSYMDRFSSELFKEIIKSQSQQNVVFSPFSVHALLALIY 142
            ::.:..||.|.:...|:..|    .|...:...|..|||::.:.....|::|||..|.|.::::.
Mouse    19 LLLITKTKHEKLYEDPSIDPFQCRKVALTICNVSITLFKKMAQLSGNGNILFSPIRVIAAISMLS 83

  Fly   143 GASDGKTFRELQKAGEFSKNAMAVAQDFESVIKYKKHL-----EGADLTLATKVYYNRELGGVNH 202
            ..|:|...:.:.:...|:|..:..| :......|..|.     |.:.|...:.|:.:::|..|: 
Mouse    84 LGSNGNLSKHILETLRFNKTGLPEA-EIHKCFWYLLHSIHQTEEPSSLQTGSSVFIHQDLTSVD- 146

  Fly   203 SYDEYAKFYFSAGTEAVDMQNAKDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQ 267
            .:.:..|..:.:...:::..::.....:||.:||:.::.:|.::|  .:::..|...:||.:.:.
Mouse   147 KFVKGVKDLYHSDMISINFTDSSQAKTQINNYVMEKSQKEIVNIV--KNLESDTFLAVVNYIIWN 209

  Fly   268 GRWEHEFATMDTSPYDFQHTNGRISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLP 332
            .:.:..|........|:....|...||.|:.|..::.|..:.:|.:|.|.|.......:...::|
Mouse   210 AKLDSNFGCRSVKVKDYHLGYGMTIKVPMIHNMAMHYLFRVEDLSSTVLMLTLLTGNFATYFIIP 274

  Fly   333 NETTGLGKML---QQLSRPEFDLNRVAHRLRRQ----SVAVRLPKFQFEFEQDMTEPLKNLGVHQ 390
            :.    |||.   |.|:.|.|      .|:|||    .|.:.:|:.......|:...:..||:..
Mouse   275 DP----GKMQKVEQSLTYPHF------RRMRRQLLTRLVDLEIPELSLSETHDLESMMSLLGITY 329

  Fly   391 MFTPNSQVTKLMDQPVRVSKILQKAYINVGEAGTEASAAS-YAKFVPLSLPPKPTEFVANRPFVF 454
            :|...:..:.:.|...:..|::.||.:.:.|.|::.|..| :.|.....:    .....||||:.
Mouse   330 VFNSGTNSSDMNDTLQKSFKVVSKAVLTIDEKGSKPSTNSCFKKLGSTDM----GRMQLNRPFLI 390

  Fly   455 AVR--TPASVLFIGHVEYP 471
            .::  |....||:|.|..|
Mouse   391 FIQDHTNDVPLFLGRVVNP 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 79/374 (21%)
Serpina1fNP_080963.2 Serpin 48..409 CDD:278507 80/378 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7631
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.