DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpina5

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001231668.1 Gene:Serpina5 / 65051 RGDID:619817 Length:442 Species:Rattus norvegicus


Alignment Length:380 Identity:93/380 - (24%)
Similarity:176/380 - (46%) Gaps:38/380 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 FSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVAQDFESVI 174
            |:..|::.:......|||.|||.||...|.::...|..||     ||.......:::.|..|.::
  Rat    83 FAFRLYRALASEAPGQNVFFSPMSVSMSLGMLSLGSGLKT-----KAQILEGLGLSLQQGQEDML 142

  Fly   175 ---------KYKKHLEGADLTLATKVYYNRELGGVNHSYDEY---AKFYFSAGTEAVDMQNAKDT 227
                     ::.:..:|..|:|.:.::.:..:    |..|.:   .|..:.:...:.:..|.:..
  Rat   143 HKGFQQLLQQFSQPSDGLQLSLGSALFTDPAV----HIRDHFLSAMKTLYMSDMFSTNFGNPESA 203

  Fly   228 AAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGRIS 292
            ..:||.:|...|..||.||:  .|:|.....::||.::|:.:|:..|::.:|...|:..|..:..
  Rat   204 KKQINDYVAKKTNGKIVDLI--KDLDSTHVMVVVNYIFFKAKWQTAFSSTNTHKMDYHVTPKKTI 266

  Fly   293 KVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLSRPEFDLNRVAH 357
            :|.||..:|:|.......:..|.:.:.|:.: |..|.:||:|    |||    .|.|..|:....
  Rat   267 QVPMMNREDIYSYILDQNISCTVVGIPYQGN-TFALFILPSE----GKM----KRVEDGLDERTL 322

  Fly   358 R-----LRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLMDQP-VRVSKILQKAY 416
            |     ..::.:.:.||||..|....:.:.|..||:..:||.::.::.|.|.. :::|:::.|:.
  Rat   323 RNWLKMFTKRQLDLYLPKFSIEGTYKLEKILPKLGIQDIFTTHADLSGLTDHTNIKLSEMVHKSM 387

  Fly   417 INVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAVRTPASVLFIGHVEYP 471
            :.|.|:||.|:|::...|...|..|...:....|||:..:....::.|||.|..|
  Rat   388 VEVDESGTTAAASTGILFTLRSARPSSLKVEFTRPFLVVIMDGTNLYFIGKVIQP 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 91/375 (24%)
Serpina5NP_001231668.1 alpha-1-antitrypsin_like 81..439 CDD:239011 91/375 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.