DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and SERPINB4

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_002965.1 Gene:SERPINB4 / 6318 HGNCID:10570 Length:390 Species:Homo sapiens


Alignment Length:384 Identity:112/384 - (29%)
Similarity:192/384 - (50%) Gaps:24/384 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 RFSSELFKEIIKSQSQQNVVFSPFSVHALLALI-YGASDGKTFRELQKAGEFSK----------- 161
            :|..:||::..||: :.|:.:||.|:.:.|.:: .||.| .|.:::.|...|.:           
Human    10 KFMFDLFQQFRKSK-ENNIFYSPISITSALGMVLLGAKD-NTAQQISKVLHFDQVTENTTEKAAT 72

  Fly   162 ----NAMAVAQDFESVI-KYKKHLEGADLTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEAVDM 221
                .:..|...|:.:: ::.|..:..:|.:|.|::..:....:....|...||| ....|:.|.
Human    73 YHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYLDAIKKFY-QTSVESTDF 136

  Fly   222 QNA-KDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQ 285
            .|| :::..|||:||...|..||::|.....:...|..:||||:||:|:||::|...:|....|.
Human   137 ANAPEESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAIYFKGQWENKFKKENTKEEKFW 201

  Fly   286 HTNGRISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLSRPEF 350
            ........|.||...:.:..|.|.::.|..||:.||....||::|||||..||.|:.::|:..:.
Human   202 PNKNTYKSVQMMRQYNSFNFALLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKL 266

  Fly   351 DLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKL-MDQPVRVSKILQK 414
            ........:|...|.:.||:|:.|...|:.:.|:.:|:..:|..::.::.: ....:.|||:|.|
Human   267 MEWTSLQNMRETCVDLHLPRFKMEESYDLKDTLRTMGMVNIFNGDADLSGMTWSHGLSVSKVLHK 331

  Fly   415 AYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAVR--TPASVLFIGHVEYP 471
            |::.|.|.|.||:||:....|.||.|....||..|.||:|.:|  ...|:||.|....|
Human   332 AFVEVTEEGVEAAAATAVVVVELSSPSTNEEFCCNHPFLFFIRQNKTNSILFYGRFSSP 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 111/379 (29%)
SERPINB4NP_002965.1 SERPIN 4..390 CDD:320777 111/382 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.