DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and LOC569077

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001188383.1 Gene:LOC569077 / 569077 -ID:- Length:384 Species:Danio rerio


Alignment Length:388 Identity:122/388 - (31%)
Similarity:189/388 - (48%) Gaps:39/388 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 FSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVAQDFESVI 174
            |:.:|::.:..|.::.|:.|||.|:.|:|:::|..:.|.|..|:::....| :...|...|||:|
Zfish    11 FALDLYQALSASSAEGNIFFSPLSISAVLSMVYLGARGDTAAEMERVLSLS-SVSDVHSHFESLI 74

  Fly   175 -KYKKHLEGADLTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEAVDMQNAKDTAAK-INAWVMD 237
             ..........|.||.::|..:....:....|...|.| .|..:.||...|.:.:.: ||.||..
Zfish    75 SSINSPSASYILRLANRLYGEKSFSFLPECLDSTMKLY-HAELQTVDFIGASEGSRQLINKWVEK 138

  Fly   238 TTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGRISKVAMMFNDDV 302
            .|.||||||:.|..|...|:..||||:||:|:|.|.|....|....|:........|.||...:.
Zfish   139 QTENKIRDLLKPGMVTTMTRLALVNAIYFKGKWTHTFQAKYTREMAFKINQKESHPVRMMHQLNK 203

  Fly   303 YGLAELPELGATALELAYKDSATSMLILLPNETTG-------------LGKMLQQLSRPEFDLNR 354
            .....|||.....|||.|.....|||||||:||..             |.|:|...:|.:.|   
Zfish   204 LPFRCLPEYKLQVLELPYIQQELSMLILLPDETKDGSDPLLKLEKELTLEKLLDWTNRDKMD--- 265

  Fly   355 VAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKL------MDQPVRVSKILQ 413
                 .:.:|.|.||||:.|.|..::|.|:.:|:..:|    |.||.      .:..:.||.::.
Zfish   266 -----TQGAVIVHLPKFKLEIESCLSETLEKMGMSSVF----QETKADLTGMGSNGGLFVSAVIH 321

  Fly   414 KAYINVGEAGTEASAASYAKFVPLSLP-PKPT-EFVANRPFVFAVR-TPA-SVLFIGHVEYPT 472
            ||:::|.|.||||:||:....:...:| |:|. .|.|:.||:|.:| .|: ::||:|....|:
Zfish   322 KAFVDVSEEGTEAAAATCVYIITSYVPRPEPRYYFTADHPFMFFIRHNPSNNILFLGRYRSPS 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 121/382 (32%)
LOC569077NP_001188383.1 SERPIN 5..383 CDD:294093 121/385 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.