DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and SERPINB13

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001294852.1 Gene:SERPINB13 / 5275 HGNCID:8944 Length:400 Species:Homo sapiens


Alignment Length:395 Identity:112/395 - (28%)
Similarity:179/395 - (45%) Gaps:36/395 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 RFSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKA--GEFSKNAMAVAQDFE 171
            |...:|||| :|..:..|:.|||..:...:.::...:.|.|..:|::.  .|....:..:..:.:
Human    10 RLGFDLFKE-LKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKAEEK 73

  Fly   172 SVIKYK---KHLEGAD---------LTLATKVYYNRELGGVN-----------HSYDEYAKFYFS 213
            .|::.|   |.:|..:         ||..:|:..:.||...|           ..|.:|.:.|:.
Human    74 EVVRIKAEGKEIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKYLDYVEKYYH 138

  Fly   214 AGTEAVDMQNAKD-TAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATM 277
            |..|.||..||.| :..|||:||...|..||:||.....:...|:.:|||.|||:|:|:.||...
Human   139 ASLEPVDFVNAADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDREFKKE 203

  Fly   278 DTSPYDFQHTNGRISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKML 342
            :|....|.........|.||.....:....|.:|.|..|.:.||::..||.:||||:..||.|::
Human   204 NTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQAKILGIPYKNNDLSMFVLLPNDIDGLEKII 268

  Fly   343 QQLSRPE--FDLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLMD-- 403
            .::| ||  .:.....| :..:.|.:.||:|:.|...|:...|..:|:...|:.:......|.  
Human   269 DKIS-PEKLVEWTSPGH-MEERKVNLHLPRFEVEDGYDLEAVLAAMGMGDAFSEHKADYSGMSSG 331

  Fly   404 QPVRVSKILQKAYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAVR--TPASVLFIG 466
            ..:...|.|..:::.|.|.||||:||:...|...|.|...... .|.||:|.:|  ...|:||.|
Human   332 SGLYAQKFLHSSFVAVTEEGTEAAAATGIGFTVTSAPGHENVH-CNHPFLFFIRHNESNSILFFG 395

  Fly   467 HVEYP 471
            ....|
Human   396 RFSSP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 111/390 (28%)
SERPINB13NP_001294852.1 SERPIN 4..400 CDD:294093 111/393 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.