DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and SERPINA5

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_000615.3 Gene:SERPINA5 / 5104 HGNCID:8723 Length:406 Species:Homo sapiens


Alignment Length:449 Identity:112/449 - (24%)
Similarity:205/449 - (45%) Gaps:60/449 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QLQLQQQLLLQQQQ----HQRNPRPELGLRSLPGNPWTQNNQEAISDVVAVDLTKREPVTPPPNR 99
            ||.|...|:|...|    |:.:|| |:..|                   ..||.....|.|...|
Human     2 QLFLLLCLVLLSPQGASLHRHHPR-EMKKR-------------------VEDLHVGATVAPSSRR 46

  Fly   100 PPPVFSYMDRFSSELFKEIIKSQSQQNVVFSPFSVH---ALLALIYGASDGKTFRE-----LQKA 156
            .         |:.:|::.:..:...|::.|||.|:.   |:|:|..|:|......|     |||:
Human    47 D---------FTFDLYRALASAAPSQSIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKS 102

  Fly   157 GEFSKNAMAVAQDFESVI-KYKKHLEGADLTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEAVD 220
            .|     ..:.:.|:.:: :..:..:|..|:|...::.:..: .:..::....|..:.|.|...:
Human   103 SE-----KELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVV-DLQDTFVSAMKTLYLADTFPTN 161

  Fly   221 MQNAKDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQ 285
            .:::.....:||.:|...|:.||.||:  .::|.....::||.::|:.:||..|....|...||.
Human   162 FRDSAGAMKQINDYVAKQTKGKIVDLL--KNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFY 224

  Fly   286 HTNGRISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLSR--P 348
            .|:..:.:|.||..:|.|.......|....:.:.|:.:||: |.:||:|    ||| ||:..  .
Human   225 VTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNATA-LFILPSE----GKM-QQVENGLS 283

  Fly   349 EFDLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLMDQP-VRVSKIL 412
            |..|.:.....:::.:.:.||||..|....:.:.|.:||:..:||.::.::.:.:.. ::||:::
Human   284 EKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMV 348

  Fly   413 QKAYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAVRTPASVLFIGHVEYP 471
            .||.:.|.|:||.|:||:...|...|........|.||||:..: ...::||:|.|..|
Human   349 HKAVVEVDESGTRAAAATGTIFTFRSARLNSQRLVFNRPFLMFI-VDNNILFLGKVNRP 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 94/371 (25%)
SERPINA5NP_000615.3 alpha-1-antitrypsin_like 44..403 CDD:239011 95/382 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.