DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and serpinb6

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001007932.1 Gene:serpinb6 / 493311 XenbaseID:XB-GENE-1001870 Length:379 Species:Xenopus tropicalis


Alignment Length:380 Identity:107/380 - (28%)
Similarity:192/380 - (50%) Gaps:29/380 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 FSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVAQDFESVI 174
            |:....|:|.:|....|:..||.|:.:.|:::...:.|.|..::.:..:..|...|.. :|:|:|
 Frog    11 FAINFLKKINESNKTGNIFVSPLSISSALSMVLLGAKGNTATQMSQVLKLDKVDDAHC-NFQSLI 74

  Fly   175 KYKKHLEGADLTLATKVYYNRELGGVNHSY-DEY---AKFYFSAGTEAVDM-QNAKDTAAKINAW 234
            . :.:..|.:..|.|.   ||..|..:::: :|:   .:.::.|..:|||. :.|:::..:||.|
 Frog    75 S-EINKSGTNYLLRTA---NRLYGEKSYTFLEEFLGSTQKHYHADLKAVDFSRKAEESRGEINEW 135

  Fly   235 VMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGRISKVAMMFN 299
            |...|..||:||::...||..|:.:||||:||:|.|.::|....|....|:........|.|||.
 Frog   136 VAQKTEGKIKDLLSSGSVDSLTRLVLVNAIYFKGNWANKFNPDHTHESPFRLNKNETKPVQMMFK 200

  Fly   300 DDVYGLAELPELGATALELAYKDSATSMLILLPNE----TTGLGKMLQQLSRPEFDLNRVAHRLR 360
            ...:.:..:.||....:|:.|.|:..||:||||::    ||||..:.::|:..:|........:.
 Frog   201 KAKFPMTYIGELFTKVVEIPYVDNELSMIILLPDDINDGTTGLEALEKELTYEKFLKWTNPEMMD 265

  Fly   361 RQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPN----SQVTKLMDQPVRVSKILQKAYINVGE 421
            ...:.:.||||:.|.:.|:...|..:|:...|...    |.::...|  :.:||:|.|::::|.|
 Frog   266 ITEMELSLPKFKLEDDYDLESFLSTMGMSDAFDQRRADFSGMSSAND--LFLSKVLHKSFVDVNE 328

  Fly   422 AGTEASAASYAKFV---PLSLPPKPTEFVANRPFVFAV--RTPASVLFIGHVEYP 471
            .||||:||:.|..:   .:.:|    ..|.:.||:|.:  |...|:||.|....|
 Frog   329 EGTEAAAATAAIMMLRCAMIIP----RIVCDHPFLFFILHRPSQSILFCGRFALP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 106/375 (28%)
serpinb6NP_001007932.1 PAI-2 4..379 CDD:239013 106/378 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.