DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpinb3b

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_941373.1 Gene:Serpinb3b / 383548 MGIID:2683293 Length:387 Species:Mus musculus


Alignment Length:392 Identity:107/392 - (27%)
Similarity:190/392 - (48%) Gaps:43/392 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 RFSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMA-------- 165
            :|:.|:::::  .:|.:|:.:||.|:...||::...:.|.|..:::|..:|.:....        
Mouse    10 KFAVEMYRQL--RESDKNIFYSPISMMTALAMLQLGAKGNTEIQIEKVLQFIETTKKTTEKSEHC 72

  Fly   166 -----VAQDFESVI-KYKKHLEGADLTLATKVYYNRELGGVN-----HSYDEYAKFYFSAGTEAV 219
                 |.:.|:.:| :..|..:..||..|..:|      |..     .::.|..|.|:.|..|::
Mouse    73 DDEENVHEQFQKLITQLNKSNDDYDLKAANSIY------GAKGFPFLQTFLEDIKEYYQAKVESL 131

  Fly   220 DMQNA-KDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYD 283
            |.::| :::..|||:||...|..||:||.....:...|..:|||||||:|:|..:|....|....
Mouse   132 DFEHATEESEKKINSWVESKTNGKIKDLFPSGSLSSSTILVLVNAVYFKGQWNRKFNENHTREEK 196

  Fly   284 FQHTNGRISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLSRP 348
            |.........|.||...:.:..:.|.::.|..:|:.||....||.:|||.|..||.::.:||:..
Mouse   197 FWLNKNTSKPVQMMKQRNKFNFSFLGDVHAQIVEIPYKGKDLSMFVLLPMEIDGLKQLEEQLTTD 261

  Fly   349 EFDLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPN-------SQVTKLMDQPV 406
            :......|..:....:.:.||:|:.|.:.|:..||:::|:...|.|.       |.:..|:    
Mouse   262 KLLEWIKAENMHLTELYLSLPRFKVEEKYDLQVPLEHMGMVDAFDPQKADFSGMSSIPGLV---- 322

  Fly   407 RVSKILQKAYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAV--RTPASVLFIGHVE 469
             |||:|.|:::.|.|.||||:||:..: |.:.......:|..:.||:|.:  |...|:||.|.:.
Mouse   323 -VSKVLHKSFVEVNEEGTEAAAATGVE-VSVRSAQIAEDFCCDHPFLFFIIHRMTNSILFFGRIC 385

  Fly   470 YP 471
            .|
Mouse   386 SP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 106/387 (27%)
Serpinb3bNP_941373.1 SERPIN 6..387 CDD:294093 106/390 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.