DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpinb3c

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_958751.2 Gene:Serpinb3c / 381286 MGIID:1277952 Length:386 Species:Mus musculus


Alignment Length:387 Identity:110/387 - (28%)
Similarity:191/387 - (49%) Gaps:34/387 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 RFSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFS--------KNAMA 165
            :|:.|:::::  .:|.:|:.:||.|:...|.::...:.|.|..:::|..:.:        |:|..
Mouse    10 KFTVEMYRQL--RESDKNIFYSPISMITALGMLKLGAKGNTEIQIEKVLQCNETTEKTTEKSAHC 72

  Fly   166 -----VAQDFESVI-KYKKHLEGADLTLATKVYYNRELGGVN-----HSYDEYAKFYFSAGTEAV 219
                 |.:.|:.:| :..|..:..||..|..:|      |..     .::.|..|.|:.|..|::
Mouse    73 DDEDNVHEQFQKLITQLNKSNDDYDLKAANSIY------GAKGFPLLQTFLEDIKEYYHANVESL 131

  Fly   220 DMQN-AKDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYD 283
            |.:: |:::..|||.||.:.|..||:||.....:...|:.:|||||||:|||.|:|...:|....
Mouse   132 DFEHAAEESEKKINFWVKNETNGKIKDLFPSGSLSSSTKLVLVNAVYFKGRWNHKFDENNTIEEM 196

  Fly   284 FQHTNGRISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLSRP 348
            |.........|.||...:.:..:.|.::.|..:|:.||....||.:|||.|..||.::.:||:..
Mouse   197 FWLNKNTSIPVPMMKQRNKFMFSFLEDVQAQIVEIPYKGKELSMFVLLPMEIDGLKQLEKQLTAA 261

  Fly   349 EFDLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLMD--QPVRVSKI 411
            :......|..:....:.:.||:|:.|.:.|:..||:.:|:...|.|.......|.  |.:.|||:
Mouse   262 KLLEWTRAENMHLTELYLWLPRFKVEEKYDLPVPLECMGMVNAFDPQKADFSGMSSTQGLVVSKV 326

  Fly   412 LQKAYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAV--RTPASVLFIGHVEYP 471
            |.|:::.|.|.||||..|| .:.|.|.| .:..:|..:.||:|.:  ....|:||.|.:..|
Mouse   327 LHKSFVEVNEEGTEADPAS-GEEVILRL-AQVADFRCDHPFLFFIIHSKTNSILFFGRISSP 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 109/382 (29%)
Serpinb3cNP_958751.2 SERPIN 6..386 CDD:294093 109/385 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.