DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and AT1G62160

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_176407.2 Gene:AT1G62160 / 3767608 AraportID:AT1G62160 Length:220 Species:Arabidopsis thaliana


Alignment Length:177 Identity:48/177 - (27%)
Similarity:74/177 - (41%) Gaps:42/177 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 GATALELAYKDSAT------SMLILLPNETTGLGKMLQQL-SRPEFDLNRVAHRLRRQSVAVRLP 369
            |...|.|.|:....      ||...||::...|..:|::: |.|.| |:....|.|.:....|:|
plant    69 GFKVLRLPYRQGRDNTNRNFSMYFYLPDKKGELDDLLKRMTSTPGF-LDSHTPRERVEVDEFRIP 132

  Fly   370 KFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLMDQPVRVSKILQKAYINVGEAGTEASAASY--- 431
            ||:.||..:.:....:..:...|                   .|||.|.:.|.||||:||:.   
plant   133 KFKIEFGFEASSVFSDFEIDVSF-------------------YQKALIEIDEEGTEAAAATAFVD 178

  Fly   432 ----AKFVPLSLPPKPTEFVANRPFVFAVR--TPASVLFIGHVEYPT 472
                ..||      :..:|||:.||:|.:|  ...:|||.|.:..|:
plant   179 NEDGCGFV------ETLDFVADHPFLFLIREEQTGTVLFAGQIFDPS 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 47/171 (27%)
AT1G62160NP_176407.2 SERPIN <43..218 CDD:294093 47/174 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.