DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpina11

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001008776.1 Gene:Serpina11 / 362774 RGDID:1359239 Length:462 Species:Rattus norvegicus


Alignment Length:444 Identity:108/444 - (24%)
Similarity:189/444 - (42%) Gaps:81/444 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 EPVTPPPNRPPPVF----SYMDRFSSELFKEIIKSQSQQNVVFSPFSVHALLALI-YGASDGKTF 150
            :|.:.....|.|.:    ..:..|:..|:|::.: :...|::|||.|:.:.:||: .||......
  Rat    34 QPASHQSLEPAPAYHKVTPTITNFALRLYKQLAE-EIPGNILFSPVSLSSTVALLSLGAHADTQA 97

  Fly   151 RELQKAGEFSKN---AMAVAQDFESVIKYKKHL-----EGADLTLATKVYYNRELGGVNHSYDEY 207
            :.||..| |:..   |..:.:.|:|::    |.     ...:|.|...::.:|:|.......|. 
  Rat    98 QILQSLG-FNLTETPAADIHRGFQSLL----HTLDLPSPKLELKLGHSLFLDRQLKPQQRFLDS- 156

  Fly   208 AKFYFSAGTEAVDMQNAKDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEH 272
            ||..:.|...:.:...|..|..:||..|...|..::...:...|.|  |..:|:|.::|:.:|:|
  Rat   157 AKELYGALAFSANFTEAAATGQQINDLVRKQTYGQVVGCLPEFDRD--TLMVLLNYIFFKAKWKH 219

  Fly   273 EFATMDTSPYDFQHTNGRIS-KVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLPNETT 336
            .|....|...:....:.|:. ::.||...:::......|...|.|::.|..:|. :|::||:.  
  Rat   220 PFDRYQTRKQESFFVDQRLQLRIPMMRQKEMHRFLYDQEASCTVLQIEYSGTAL-LLLVLPDP-- 281

  Fly   337 GLGKMLQ--------------QLSRP-------------------EFDLNRVA-----HRLRRQS 363
              |||.|              |...|                   ||..|||.     |....|:
  Rat   282 --GKMQQVEAALQPETLRRWGQRFLPRKAQAGGAGNGGLHWDRVNEFPQNRVGKLSLKHLQMTQT 344

  Fly   364 ---VAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLMDQPVR-VSKILQKAYINVGEAGT 424
               :.:.||:|......::.|.|..:|:..:|...:.::.:|.|..: ||::..||.:::.|.||
  Rat   345 WSLLDLHLPRFSVSATYNLEEILPLVGLSSLFDVEADLSGIMGQLNKTVSRVSHKAVVDMNEKGT 409

  Fly   425 EASAASYAKFVPLSLPPKPTEFVA-----NRPFVFAV--RTPASVLFIGHVEYP 471
            ||:|||..    ||.||......|     ||||:..:  .|..|:||:|.|..|
  Rat   410 EAAAASGL----LSQPPSLNMTSAPHAHFNRPFLLLLWEVTTQSLLFLGKVVNP 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 103/418 (25%)
Serpina11NP_001008776.1 alpha-1-antitrypsin_like 53..456 CDD:239011 103/420 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.