DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and serpina1

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_017207927.1 Gene:serpina1 / 322701 ZFINID:ZDB-GENE-030131-1421 Length:433 Species:Danio rerio


Alignment Length:395 Identity:106/395 - (26%)
Similarity:182/395 - (46%) Gaps:67/395 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 FSSELFKEIIKSQSQQ--NVVFSPFSVHALLALIYGASDGKTFRELQKA-GEFSKNAMAVAQDFE 171
            |:..|:|::..:...|  |:.|||..:...|:|:...:...|..::... |..:.....|.:.:|
Zfish    73 FAFSLYKKLASNPDGQGKNIFFSPVGISMALSLLAVGAKASTLSQIYSGLGYSALTPEQVNEGYE 137

  Fly   172 SVIKYKKHLE-------GADLTL--ATKV----------YYNRELGGVNHSYDEYAKFYFSAGTE 217
            .::....|.:       ||.:.:  ..||          |||.|..||:.|..|.|         
Zfish   138 HLLHMLGHSQDAMQLEAGAGVAIRDGFKVVDQFLKDAQHYYNSEAFGVDFSKPEIA--------- 193

  Fly   218 AVDMQNAKDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPY 282
                      ||:||.::...|.:||.::|  .|:|..|..:|:|.:||:|:||..|....|...
Zfish   194 ----------AAEINKFIARKTHDKITNMV--KDLDADTVMMLINYMYFRGKWEKPFDAKLTHKA 246

  Fly   283 DFQHTNGRISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLSR 347
            ||:.......:|.||.....|.:.:.|....|.:.:.||.: |||:|:||::    |||      
Zfish   247 DFKVDQDTTVQVDMMKRTGRYDIYQDPVNQTTVMMVPYKGN-TSMMIVLPDD----GKM------ 300

  Fly   348 PEFDLNRVAHRLR-------RQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLMDQ- 404
            .|.:.:...|.|:       |.||.:.:|||.......:...||::|:...|...:..:.:.:: 
Zfish   301 KELEESICRHHLKNWHDKLFRSSVDLFMPKFSISATSKLDGILKDMGMTDAFNDKADFSGMTEEV 365

  Fly   405 PVRVSKILQKAYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAV--RTPASVLFIGH 467
            .|:||::|.:|.::|.|.||||:|.:..:.:|:||   |...:.||||:..:  .:..|:||:|.
Zfish   366 KVKVSQVLHQAVMSVDEKGTEAAAITTIEIMPMSL---PDTVILNRPFLVLIVEDSTMSILFMGK 427

  Fly   468 VEYPT 472
            :..||
Zfish   428 ITNPT 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 104/389 (27%)
serpina1XP_017207927.1 alpha-1-antitrypsin_like 69..428 CDD:239011 104/389 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.