DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpine3

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_017171543.1 Gene:Serpine3 / 319433 MGIID:2442020 Length:404 Species:Mus musculus


Alignment Length:375 Identity:88/375 - (23%)
Similarity:161/375 - (42%) Gaps:53/375 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 FSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVAQDFESVI 174
            |:..|::.....::..|.|.||.||...|.::...:.|.|..:|..|..::.....| ::|...:
Mouse    35 FALHLYRSAAAERNGTNFVISPASVSLSLEILQFGARGNTGWQLAGALGYTVQDPRV-KEFLHAV 98

  Fly   175 KYKKH--LEGADLTLATKVYYNRELG-GVNHSYDEYAKFYFSAGTEAVDMQNAKDT---AAKINA 233
            ...:|  .:|..:.||..::  .:.| .::..:.|....:.::..||.|......|   |:|:  
Mouse    99 YTTRHNSSQGVGMELACTLF--MQTGTSLSPCFVEQVSRWANSSLEAADFSEPNSTTTEASKV-- 159

  Fly   234 WVMDTTRNKIRDLVTPTDVDP-----------QTQALLVNAVYFQGRWEHEFATMDTSPYDFQHT 287
                |:|..       |...|           .||..:::.:.||..|:..|:.: ..|..|.|.
Mouse   160 ----TSRQS-------TGEGPDSPLWGRADALSTQLSIMSTMTFQSTWQKRFSVV-LQPLPFTHA 212

  Fly   288 NGRISKVAMMFNDDVYGLAELPELGA---TALELAYKDSATSMLILLPNET-TGLGKMLQQLSRP 348
            :|.:.:|..|.........:..:...   ..|||.|.....|:|::||.:. |.|..:...|:. 
Mouse   213 HGLVLQVPAMHQVAEVSYGQFQDAAGHEIAVLELLYLGRVASLLLVLPQDKGTPLDHIEPHLTA- 276

  Fly   349 EFDLNRVAH----RLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTP-NSQVTKLMDQP-VR 407
                 ||.|    ||:|..:.|.||:|:.:.:.|:...|::.|:..:|.| .:.:..:..|. ..
Mouse   277 -----RVLHLWTTRLKRARMDVFLPRFKIQNQFDVKSILRSWGITDLFDPLKANLKGISGQDGFY 336

  Fly   408 VSKILQKAYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAVR 457
            ||::..||.:.:.|.||.:|||:....:..|   :.:.|.|:|||:|.:|
Mouse   337 VSQLTHKAKMELSEEGTRSSAATAVLLLRRS---RTSAFKADRPFIFLLR 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 88/375 (23%)
Serpine3XP_017171543.1 serpin 20..388 CDD:393296 88/375 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.