DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpina1f

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001101524.1 Gene:Serpina1f / 314406 RGDID:1307899 Length:412 Species:Rattus norvegicus


Alignment Length:423 Identity:84/423 - (19%)
Similarity:182/423 - (43%) Gaps:64/423 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 VVAVDLTKREPVTPPPNRPP----PVFSYMDRFSSELFKEIIKSQSQQNVVFSPFSVHALLALIY 142
            ::.:..||.|.:...||..|    .|...:...|..||||:.:.....|::|||..|.|.::::.
  Rat    19 LLPITKTKYEDLYEDPNIDPFQCRKVALTISNISITLFKEMAQLSVNGNILFSPIRVIAAISMLS 83

  Fly   143 GASDGKTFRELQKAGEFSKNAMAVAQDFESVIKYKKHL--------EGADLTLATKVYYNRELGG 199
            ..:.|...:.:.:....:|..:..|:    :.|..::|        :.:.|...:.|:.:::|..
  Rat    84 LGAKGNESKRILEILRLNKTGLPEAE----IHKCFRYLLRAIHQPEQLSPLKSGSGVFIHQDLTP 144

  Fly   200 VNHSYDEYAKFYFSAGTEAVDMQNAKDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAV 264
            |: .:.|..|..:.:...:::..:.:....:||.::|..:..:|:::|  .:::..|...:||.:
  Rat   145 VD-KFVEGVKNLYHSDIVSINFTDCRRAKTQINNYMMTKSNKEIKNIV--KNLENDTYMAVVNYI 206

  Fly   265 YFQGRWEHEFATMDTSPYDFQHTNGRISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLI 329
            .:..:...:|........|:....|...||.|:...|:..|..:.:|.:|.|......|..:...
  Rat   207 IWNAKINSDFGCRSVKQKDYHLEQGMTIKVPMIHIVDLNHLFRVEDLSSTVLVFTLLASNFTTYF 271

  Fly   330 LLPNETTGLGKML---QQLSRPEFDLNRVAHRLRRQS----VAVRLPKFQFEFEQDMTEPLKNLG 387
            ::|:    :|:|.   |:|:.|.|      .|:||||    |.:..|:.......|:...:..||
  Rat   272 IIPD----IGQMQKVEQRLTYPHF------RRMRRQSNLRMVNLETPELSLSETHDVESMMNLLG 326

  Fly   388 VHQMFTPNSQVTKLMDQPVRVS-KILQKAYINVGEAGTEASAAS-----------YAKFVPLSLP 440
            :..:|..::..:.:|:..::.| |::.|..:.:.:.|::...::           |.:|      
  Rat   327 ITYVFNNDANSSAVMNDTLQKSFKMVSKVKLTIDDKGSKPGRSTCFKNDGSVDVGYVQF------ 385

  Fly   441 PKPTEFVANRPFVFAVRTPAS--VLFIGHVEYP 471
                    ||||:..::.|.:  .||:|.|..|
  Rat   386 --------NRPFLIFIKDPTNDVPLFLGRVVNP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 75/388 (19%)
Serpina1fNP_001101524.1 serpin 47..410 CDD:422956 76/393 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.