DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and serpinh1b

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001296752.1 Gene:serpinh1b / 30449 ZFINID:ZDB-GENE-990415-93 Length:405 Species:Danio rerio


Alignment Length:390 Identity:95/390 - (24%)
Similarity:160/390 - (41%) Gaps:66/390 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 LFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVAQDFESVIK--- 175
            |:..:.|.:..:|::.||..|.:.|.::...|...|                 |...:||:|   
Zfish    41 LYHNVAKEKGLENILISPVVVASSLGMVAMGSKSST-----------------ASQVKSVLKADA 88

  Fly   176 -YKKHLEGADLTLATKV-----------YYNRELGGVNHSYDE----YAKFYFSAGTEAVDMQNA 224
             ..:||......|.|:|           ..||..|..:.|:.|    .:|.:::.....::.::.
Zfish    89 LKDEHLHTGLSELLTEVSDPQTRNVTWKISNRLYGPSSVSFAEDFVKNSKKHYNYEHSKINFRDK 153

  Fly   225 KDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNG 289
            :.....||.|...||..|:.::.  .||.....|::|||::|:..|:.:|.........|..|..
Zfish   154 RSAINSINEWAAKTTDGKLPEIT--KDVKNTDGAMIVNAMFFKPHWDEKFHHKMVDNRGFLVTRS 216

  Fly   290 RISKVAMMFNDDVYGLAELPE--LGATALELAYKDSATSMLILLPNETTGLGKMLQQLSRPEFDL 352
            ....|.||....:||..|..|  ....::.||:|.|  ||:.::|.....|.::...|:|.:.| 
Zfish   217 HTVSVPMMHRTGIYGFYEDTENRFLIVSMPLAHKKS--SMIFIMPYHVEPLDRLENLLTRQQLD- 278

  Fly   353 NRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLMDQ-PVRVSKILQK-- 414
             ....:|..::||:.|||...|...|:.:.|..||          :|:.:|: ...:|.|..|  
Zfish   279 -TWISKLEERAVAISLPKVSMEVSHDLQKHLGELG----------LTEAVDKSKADLSNISGKKD 332

  Fly   415 AYI-NVGEAG-----TEASAASYAKFVPLSLPPKPTEFVANRPFVFAVR--TPASVLFIGHVEYP 471
            .|: ||..|.     ||.:....:.|....: ..|..|.|:.||:|.|:  ...|:||||.:..|
Zfish   333 LYLSNVFHASSLEWDTEGNPFDPSIFGSEKM-RNPKLFYADHPFIFLVKDNKTNSILFIGRLVRP 396

  Fly   472  471
            Zfish   397  396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 94/385 (24%)
serpinh1bNP_001296752.1 hsp47 28..393 CDD:239001 94/385 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.