DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpina3m

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001257911.1 Gene:Serpina3m / 299276 RGDID:735068 Length:419 Species:Rattus norvegicus


Alignment Length:388 Identity:108/388 - (27%)
Similarity:186/388 - (47%) Gaps:51/388 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 FSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVAQDFESVI 174
            |:..|:|.:......:||||||.|:.|.||::...:.|.|..|:.:...|:     :.:.:|:.|
  Rat    54 FAFSLYKMLALKNPDKNVVFSPLSISAALAIVSLGAKGNTLEEILEVLRFN-----LTESYETDI 113

  Fly   175 KYK-KHL------EGADLTLAT--KVYYNRELGGVNHSYDEYAKFYFSAGTEAVDMQNAKDTAAK 230
            ... .||      .|..:.:.|  .::.::.| .|...:.|..:..:.......|.|..:.|...
  Rat   114 HQGFGHLLQRLSQPGDQVKIITGNALFIDKNL-QVLAEFQEKTRALYQVEAFTADFQQPRVTEKL 177

  Fly   231 INAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGRISKVA 295
            ||.:|.:.|:.||::||  :.:..:|..:|||.:.|:|:|:..|....|...:|.....|..||:
  Rat   178 INDYVRNQTQGKIQELV--SGLKERTSMVLVNYLLFRGKWKVPFDPDYTFESEFYVDEKRSVKVS 240

  Fly   296 MM---------FNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLS---RP 348
            ||         |.|:        ||..:.|||.|..: :|.|.:||::    |:| ||:.   :|
  Rat   241 MMKIEELTTPYFRDE--------ELSCSVLELKYTGN-SSALFILPDK----GRM-QQVEASLQP 291

  Fly   349 EFDLNRVAHRLRRQSV-AVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLMD-QPVRVSKI 411
            | .|.:....||.:.: .:.||:.....:..:.|.|..||:..:|:..:.::::.. :.:.||::
  Rat   292 E-TLKKWKDSLRPRKIDELYLPRLSISTDYSLEEVLPELGIRDVFSQQADLSRITGAKDLSVSQV 355

  Fly   412 LQKAYINVGEAGTEASAASYAKFVPLS-LPPKPTEFVANRPFVFAVRTP--ASVLFIGHVEYP 471
            :.|..::|.|.||||:||:.|..||.| .||....|  ||||:.||...  .::||:..|..|
  Rat   356 VHKVVLDVNETGTEAAAATGANLVPRSGRPPMIVWF--NRPFLIAVSHTHGQTILFMAKVINP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 106/383 (28%)
Serpina3mNP_001257911.1 SERPIN 56..416 CDD:214513 106/384 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.