DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpina16

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_853661.2 Gene:Serpina16 / 299271 RGDID:727888 Length:415 Species:Rattus norvegicus


Alignment Length:420 Identity:88/420 - (20%)
Similarity:170/420 - (40%) Gaps:65/420 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 EPVTPPP------------NRPPPVFSYMDRFSSELFKEIIKSQSQQNVVFSPFSVHALLALIYG 143
            :|.||||            ...||.|: ..:|:..|:|::.:.:..:|::|||..:...|.|:..
  Rat    21 DPQTPPPPEASNMSQIPVTQGAPPFFN-NQKFALSLYKQLPQPKRGKNLIFSPLGIIVPLVLLAF 84

  Fly   144 ASDGKTFRE-LQKAGEFSKNAM--AVAQDFESVIKYKKHLEGADLTLATKVYYNRELGGVNHSYD 205
            ....|...: ||..|.....|:  ..|.::..::....|.:...:...:.::.::.|.... ::.
  Rat    85 QDKPKARHQVLQDLGFTVTGALDTKAASEYGKLLSNLLHTKNCGIYTGSLLFIDKTLKPAK-TFV 148

  Fly   206 EYAKFYFSAGTEAVDMQNAKDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRW 270
            :.|...:::....:...|......:|:..:...|..||..|:  ..:.|.|...|.|..:|:|:|
  Rat   149 KLANSSYNSNVVLISFGNYGLAQKQIDLAIRARTHGKITKLL--RILKPPTNLFLANYNFFKGKW 211

  Fly   271 EHEFATMDTSPYDFQHTNGRISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLPNET 335
            ::.|....|....|...:|..:.|.||.....:.|....::.:..|:|.:..| .|.:..||:: 
  Rat   212 KYPFNRKHTRMRYFWLEDGTKTLVPMMQRVGWFQLQYFSQMHSYVLQLPFTCS-ISGVFFLPDD- 274

  Fly   336 TGLGKMLQQLSRPEFDLNRVAHRLRRQSVAVRL------------PKFQFEFEQDMTEPLKNLGV 388
               ||         |:.:..|  |..||....:            |||.......: |.||::..
  Rat   275 ---GK---------FEESEKA--LLEQSFETWIQPFPMSKRWLFFPKFSIPVALHL-ENLKHVNS 324

  Fly   389 H-QMFTPNSQVTK--LMDQPVRVSKILQKAYINVGEAGTEASAASYAKFVPLSLPPKP--TEFVA 448
            : ::|:.:..:::  |...|:.||..:.:..:.|.|.|.|...:.          |:|  .....
  Rat   325 NIKLFSEHMDLSRITLQKAPLTVSTAVHRVELTVNEDGEEKDESQ----------PEPDLATLHF 379

  Fly   449 NRPFVFAV--RTPASVLFIGHVEYPTPMSV 476
            ||.|:..:  .|..|:||:|.|..||.:::
  Rat   380 NRSFLLLILDETSNSLLFMGKVVNPTRINM 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 77/381 (20%)
Serpina16NP_853661.2 serpinA16_HongrES1-like 40..406 CDD:381053 82/396 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.