DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpinh1

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_058869.2 Gene:Serpinh1 / 29345 RGDID:69302 Length:417 Species:Rattus norvegicus


Alignment Length:368 Identity:84/368 - (22%)
Similarity:159/368 - (43%) Gaps:22/368 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 LFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVAQDFESVIKYKK 178
            |::.:.|.|:.:|::.||..|.:.|.|:  :..||.....|.....|...:...:....:.:..:
  Rat    53 LYQAMAKDQAVENILLSPLVVASSLGLV--SLGGKATTASQAKAVLSAEKLRDEEVHTGLGELLR 115

  Fly   179 HLEGADLTLATKVYYNRELGGVNHSY-DEY---AKFYFSAGTEAVDMQNAKDTAAKINAWVMDTT 239
            .|..:.....|....:|..|..:.|: |::   :|.:::.....::.::.:.....||.|...||
  Rat   116 SLSNSTARNVTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKRSALQSINEWASQTT 180

  Fly   240 RNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGRISKVAMMFNDDVYG 304
            ..|:.::.  .||:....||||||::|:..|:.:|.........|..|......|.||....:|.
  Rat   181 DGKLPEVT--KDVERTDGALLVNAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVTMMHRTGLYN 243

  Fly   305 L--AELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLSRPEFDLNRVAHRLRRQSVAVR 367
            .  .|..:|....:.||:|  .:|::||:|:....|.::.:.|::.:  |.....::::::||:.
  Rat   244 YYDDEKEKLQLVEMPLAHK--LSSLIILMPHHVEPLERLEKLLTKEQ--LKTWMGKMQKKAVAIS 304

  Fly   368 LPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLMD--QPVRVSKILQKAYINVGEAGTEASAAS 430
            |||...|...|:.:.|..||:.:....|......|.  :.:.::.:...........|.......
  Rat   305 LPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFEWDTEGNPFDQDI 369

  Fly   431 YAKFVPLSLPPKPTEFVANRPFVFAVR--TPASVLFIGHVEYP 471
            |.:....|    |..|.|:.||:|.||  ...|:||||.:..|
  Rat   370 YGREELRS----PKLFYADHPFIFLVRDNQSGSLLFIGRLVRP 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 83/363 (23%)
Serpinh1NP_058869.2 serpinH1_CBP1 35..416 CDD:381003 84/368 (23%)
Prevents secretion from ER. /evidence=ECO:0000305 414..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.