DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpinb6e

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_006253937.2 Gene:Serpinb6e / 291087 RGDID:1561697 Length:379 Species:Rattus norvegicus


Alignment Length:382 Identity:101/382 - (26%)
Similarity:183/382 - (47%) Gaps:49/382 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 IIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQK-----------AGEFSKNAMAVAQDFE 171
            ::...|.:||.|||.|:.:.|::|...::|.|..::.|           .|:|.       |.|:
  Rat    18 VLGEDSSKNVFFSPLSMFSSLSMILLGANGTTASQISKVLSLYNCNGNGGGDFH-------QCFQ 75

  Fly   172 SVI-----KYKKHLEGADLTLATKVYYNRELGGVNHSYDEYAKF------YFSAGTEAVDMQNAK 225
            |::     ..::|:    |..:..|:       |..|::..|.|      ::.|..|.:|.:.|.
  Rat    76 SLLTEVNKSDRRHM----LKTSNSVF-------VEDSFEILASFKDSCRKFYEAEIENMDFKGAP 129

  Fly   226 DTAAK-INAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNG 289
            :.:.: ||.||...|.:.||:|::|..|:..||.:|:|:.||:|.||..|...||....|:.:..
  Rat   130 EQSRQHINTWVAKKTEDVIRELLSPGTVNSNTQLVLMNSFYFKGNWEKPFNKEDTREMPFKVSKN 194

  Fly   290 RISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLSRPE-FDLN 353
            ....|.||||...:....:.::..|...|.|..:..|:.|:||:|...|..:..|::..: .:..
  Rat   195 EKKIVQMMFNKSNFRTYHVEDISTTLALLPYLGNQLSITIMLPDEYVELRTVENQITYEKLIEWT 259

  Fly   354 RVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTP-NSQVTKLMDQP-VRVSKILQKAY 416
            |: ..::.:.|.:.||:|:.|...||...|..||:...|.. .:..:.:..:| :.:||::.|:.
  Rat   260 RL-ENMQEEEVEILLPRFKLEESYDMKNVLCKLGMTNAFEDGRADFSGISSKPGLFLSKVVHKSV 323

  Fly   417 INVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAVRTP--ASVLFIGHVEYP 471
            :.|.|.||||:|.:  :.|.:..|..|...||:.||:|.::..  .::||:|....|
  Rat   324 VEVNEEGTEAAAPT--EIVTMGSPLSPQCLVADHPFLFLIQDDRNKAILFLGRFSSP 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 100/377 (27%)
Serpinb6eXP_006253937.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.