DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpinf1

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_808788.1 Gene:Serpinf1 / 287526 RGDID:631369 Length:418 Species:Rattus norvegicus


Alignment Length:458 Identity:108/458 - (23%)
Similarity:194/458 - (42%) Gaps:103/458 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 SLPGNPWTQNNQEAISDVVAVDLTKREPVT--------PPPNRPPPVFSYMDRFSSELFKEIIKS 121
            :|.|:..:||..::..|..|.|.| .|||.        .|.|:   :.:.:..|..:|::....:
  Rat    12 ALLGHGSSQNVPDSSQDSPAPDST-GEPVVEEDDPFFKAPVNK---LAAAVSNFGYDLYRLRSGA 72

  Fly   122 QSQQNVVFSPFSV-HALLALIYGASDGKTFRELQKA---------------GEFSKNAMAVAQDF 170
            .|..|::.||.|| .||.||..|| :.:|...:.:|               .|...:..|..::|
  Rat    73 VSTGNILLSPLSVATALSALSLGA-EQRTESVIHRALYYDLINNPDIHSTYKELLASVTAPEKNF 136

  Fly   171 ESVIKYKKHLEGADLTLATKVYYNREL-------GGVNHSYDEYAKFYFSAGTEAVDMQNAKDTA 228
            :|               |:::.:.|:|       ..:..||....:..  .|...:|:|      
  Rat   137 KS---------------ASRIVFERKLRVKSSFVAPLEKSYGTRPRIL--TGNPRIDLQ------ 178

  Fly   229 AKINAWVMDTTRNKI----RDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNG 289
             :||.||....:.||    |::.:...:      ||:...||:|:|..:|.:..|:..||.....
  Rat   179 -EINNWVQAQMKGKIARSTREMPSALSI------LLLGVAYFKGQWATKFDSRKTTLQDFHLDED 236

  Fly   290 RISKVAMMFNDDV---YGL--------AELPELGATALELAYKDSATSMLILLPNETTGLGKMLQ 343
            |..:|.||.:...   |||        |:||..|           :.|::..||...|....|::
  Rat   237 RTVRVPMMSDPKAILRYGLDSDLNCKIAQLPLTG-----------SMSIIFFLPLTVTQNLTMIE 290

  Fly   344 QLSRPEF--DLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLMDQPV 406
            :....||  |::|   .|:.....:.:||.:..:|.|:|..|:::.:..:| .:...:|:..:||
  Rat   291 ESLTSEFVHDIDR---ELKTIQAVLTVPKLKLSYEGDVTNSLQDMKLQSLF-ESPDFSKITGKPV 351

  Fly   407 RVSKILQKAYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAVR--TPASVLFIGHVE 469
            :::::..:|.....|.|  |..:|.....|:.| ..|.::..||||:|.:|  ...::||||.:.
  Rat   352 KLTQVEHRAAFEWNEEG--AGTSSNPDLQPVRL-TFPLDYHLNRPFIFVLRDTDTGALLFIGRIL 413

  Fly   470 YPT 472
            .|:
  Rat   414 DPS 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 94/401 (23%)
Serpinf1NP_808788.1 PEDF 40..415 CDD:239007 96/426 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.