DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpina3b

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_766612.1 Gene:Serpina3b / 271047 MGIID:2182835 Length:420 Species:Mus musculus


Alignment Length:365 Identity:92/365 - (25%)
Similarity:168/365 - (46%) Gaps:36/365 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 FSSELFKEIIKSQSQQNVVFSPFSV-HALLALIYGASDGKTFRELQKAGEFSKNAMAVA---QDF 170
            |:...:||:......:|:.||||.: .||.:|..||. |.|..|:.:..:|:....:.|   |.|
Mouse    54 FAFSFYKELALKNPHKNIAFSPFGIATALNSLTLGAK-GNTLEEILEVLKFNLTETSEADIHQGF 117

  Fly   171 ESVIKYKKHLEGADLTLAT--KVYYNRELGGVNHSYDEYAKFYFSAGTEAVDMQNAKDTAAKINA 233
            :.:::...| .|..:.:.|  .::..:.| .:...:.|.|:..:.......:.|...:....||:
Mouse   118 KHLLQRLSH-PGDQVQIRTGNALFVEKHL-QILAEFKEKARALYHTEVFTANFQQPHEAMKLINS 180

  Fly   234 WVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGRISKVAMM- 297
            ::.:.|:.||::||  :|:|..|..::||.::|:..|...|.:.||....|.....|..||.|| 
Mouse   181 YMSNQTQGKIKELV--SDMDGNTSMVIVNDLFFKAEWMVPFNSDDTFMGKFIVDRSRHVKVPMMK 243

  Fly   298 --------FNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQ-QLSRPEFDLN 353
                    |.|:        ||..|.:||.||.:..:|.| ||::    |||.| :.|.....|.
Mouse   244 TKNLRTPYFRDE--------ELKCTVVELNYKGNGKAMFI-LPDQ----GKMQQVEASLQPGTLK 295

  Fly   354 RVAHRLR-RQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLMD-QPVRVSKILQKAY 416
            :....|| |:...:.||||......::.:.|..||:.::|:..:.::.:.. :.:.||:::....
Mouse   296 KWRKSLRPRKIKELHLPKFSLSQHYNLEDILPELGIRELFSTQADLSGITGVKNITVSEMIHSTE 360

  Fly   417 INVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAV 456
            :::.|.|||..|.:...:..:|...||........|::.|
Mouse   361 LDMTEKGTEGDAITIVGYNFMSAKLKPVFVKFEDQFLYIV 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 92/365 (25%)
Serpina3bNP_766612.1 SERPIN 51..414 CDD:294093 92/365 (25%)
RCL 367..392 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.