DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpinb10

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_714955.2 Gene:Serpinb10 / 266775 RGDID:628853 Length:397 Species:Rattus norvegicus


Alignment Length:397 Identity:105/397 - (26%)
Similarity:195/397 - (49%) Gaps:39/397 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 MDRFSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEF------------ 159
            :::|:.|..|::.:|...:|:.|||:.:...||::|..:.|.|..::.:...|            
  Rat     8 INQFAVEFSKKLAESAEGRNIFFSPWGISTSLAMVYLGTKGTTAAQMSQVLHFGSIQDFKFGPDS 72

  Fly   160 ---------SKNAMAVAQDFESV-IKYKKHLEGADLTLATKVYYNRELGGVNHSYDEYAKFYFSA 214
                     |..:..:..||::: .|..||.....|.:|.::|..:.. ..::.|.|..|.||.|
  Rat    73 EKKRKMECHSGKSEEIQSDFQTLTAKILKHGNSYVLKIANRIYVEKTY-LFHNKYLEDMKTYFGA 136

  Fly   215 GTEAVDMQNAKDTAAK-INAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMD 278
            ..::|:...|.....| ||:||...|..||.:|:....||.:|..:||||:||:|.|||:|:..:
  Rat   137 EPQSVNFVEASGQIRKEINSWVGSQTGGKIPNLLPDDAVDNKTTMVLVNALYFKGTWEHQFSVQN 201

  Fly   279 TS--PYDFQHTNGR-ISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGK 340
            |:  |:....|..: :..::|..:..|:.:.||..:|   ::|.|::...|:|:|||.|..||.:
  Rat   202 TTERPFRINKTTSKPVQMMSMKQSLQVFHIEELQTIG---VQLHYQNREFSLLLLLPEEVEGLKQ 263

  Fly   341 MLQQLSRPEFDLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPN----SQVTKL 401
            :.:.::..:.|....|..:....|.:.||||:.|...|:...|:::|:...|...    |.:|. 
  Rat   264 LERAITYEKLDKWTSADMMDTYEVQLYLPKFKMEESYDLQSALRDMGMTDAFNQGKANFSNMTS- 327

  Fly   402 MDQPVRVSKILQKAYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAVR--TPASVLF 464
             ::.:.:|.:..|.::.:.|.||||:|.:.:: |...:.....|..|:.||:|.:|  ...::||
  Rat   328 -ERNLFLSNVFHKTFLEINEEGTEAAAGTGSE-VNFRIKAPSIELNADHPFLFLIRHNVTNTILF 390

  Fly   465 IGHVEYP 471
            .|....|
  Rat   391 YGRFYSP 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 104/391 (27%)
Serpinb10NP_714955.2 SERPIN 4..397 CDD:294093 104/395 (26%)
Nuclear localization signal. /evidence=ECO:0000250 74..77 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.