DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and SERPINA11

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001073920.1 Gene:SERPINA11 / 256394 HGNCID:19193 Length:422 Species:Homo sapiens


Alignment Length:410 Identity:103/410 - (25%)
Similarity:183/410 - (44%) Gaps:56/410 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PPPNR-----PPPVF----SYMDRFSSELFKEIIKSQSQQNVVFSPFSVHALLALI-YGASDGKT 149
            |.|.|     |.|.:    ..:..|:..|:|| :.:.:..|:.|||.|:...|||: .||....:
Human    33 PQPPRHQLSEPAPAYHRITPTITNFALRLYKE-LAADAPGNIFFSPVSISTTLALLSLGAQANTS 96

  Fly   150 FRELQKAG-EFSKNAMA-VAQDFESVIKYKKHL-----EGADLTLATKVYYNRELGGVNHSYDE- 206
            ...|:..| ..::...| :.|.|.|::    |.     ...:|.:...::.::.|....|..|. 
Human    97 ALILEGLGFNLTETPEADIHQGFRSLL----HTLALPSPKLELKVGNSLFLDKRLKPRQHYLDSI 157

  Fly   207 ---YAKFYFSAG-TEAVDMQNAKDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQ 267
               |..|.|||. |::|      .|..:||.::...|..::.|.:.....|  |..:|.|.::|:
Human   158 KELYGAFAFSANFTDSV------TTGRQINDYLRRQTYGQVVDCLPEFSQD--TFMVLANYIFFK 214

  Fly   268 GRWEHEFATMDTSPYDFQHTNGRIS-KVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILL 331
            .:|:|.|:...|...:....:.|.| :|.||...:::......:|..|.|::.|:.:|.::|: |
Human   215 AKWKHPFSRYQTQKQESFFVDERTSLQVPMMHQKEMHRFLYDQDLACTVLQIEYRGNALALLV-L 278

  Fly   332 PNETTGLGKMLQQLSRPEFDLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNS 396
            |:  .|..|.::...:|: .|.:....|....:.:.||:|......::.:.|..:|:..:....:
Human   279 PD--PGKMKQVEAALQPQ-TLRKWGQLLLPSLLDLHLPRFSISGTYNLEDILPQIGLTNILNLEA 340

  Fly   397 QVTKLMDQPVR-VSKILQKAYINVGEAGTEASAASYAKFVPLSLPPK-------PTEFVANRPFV 453
            ..:.:..|..: :||:..||.:::.|.||||.|||..    ||.||.       ...|  ||||:
Human   341 DFSGVTGQLNKTISKVSHKAMVDMSEKGTEAGAASGL----LSQPPSLNTMSDPHAHF--NRPFL 399

  Fly   454 FAV--RTPASVLFIGHVEYP 471
            ..:  .|..|:||:|.|..|
Human   400 LLLWEVTTQSLLFLGKVVNP 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 96/383 (25%)
SERPINA11NP_001073920.1 alpha-1-antitrypsin_like 53..416 CDD:239011 96/385 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.