DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpina1

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_071964.2 Gene:Serpina1 / 24648 RGDID:3326 Length:411 Species:Rattus norvegicus


Alignment Length:387 Identity:109/387 - (28%)
Similarity:186/387 - (48%) Gaps:37/387 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 VFSYMDRFSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVA 167
            :.|.:..|:..|::|::...:..|:.|||.|:....|::...|.|.|.:::.:..||:...:..|
  Rat    44 ISSNLADFAFSLYRELVHQSNTSNIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPEA 108

  Fly   168 QDFESVIKYKKHLEGAD----LTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEAVDMQNAKDTA 228
            ...::.....:.|...|    |.....::.|:.|..|....:|....|.|   ||..:..|....
  Rat   109 DIHKAFHHLLQTLNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHS---EAFSVNFADSEE 170

  Fly   229 AK--INAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGRI 291
            ||  ||.:|...|:.||.||:...|.|  |...|||.::|:|:|:..|....|...||.......
  Rat   171 AKKVINDYVEKGTQGKIVDLMKQLDED--TVFALVNYIFFKGKWKRPFNPEHTRDADFHVDKSTT 233

  Fly   292 SKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKM--LQQ------LSRP 348
            .||.||....::.:.....|.:..|.:.|..:||: :.|||::    |||  |:|      :|| 
  Rat   234 VKVPMMNRLGMFDMHYCSTLSSWVLMMDYLGNATA-IFLLPDD----GKMQHLEQTLTKDLISR- 292

  Fly   349 EFDLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLM-DQPVRVSKIL 412
             |.|||     :.:|..:..||.......::...|.:||:.::|..::.::.:. |.|:::|:.:
  Rat   293 -FLLNR-----QTRSAILYFPKLSISGTYNLKTLLSSLGITRVFNNDADLSGITEDAPLKLSQAV 351

  Fly   413 QKAYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAV--RTPASVLFIGHVEYPT 472
            .||.:.:.|.||||:.|:..:.||:||||: .:|  :.||:|.:  ....|.||:|.|..||
  Rat   352 HKAVLTLDERGTEAAGATVVEAVPMSLPPQ-VKF--DHPFIFMIVESETQSPLFVGKVIDPT 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 105/376 (28%)
Serpina1NP_071964.2 alpha-1-antitrypsin_like 49..406 CDD:239011 105/376 (28%)
RCL 367..386 8/21 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.