DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpinb10

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_006529660.1 Gene:Serpinb10 / 241197 MGIID:2138648 Length:382 Species:Mus musculus


Alignment Length:281 Identity:78/281 - (27%)
Similarity:133/281 - (47%) Gaps:37/281 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 RFSS-ELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVAQDFES 172
            :||| |.||....|:.::.:.|               :.|| |.|:|  .:|...|..:.:...|
Mouse    19 QFSSVEDFKSCPDSEKKRKMEF---------------NSGK-FEEIQ--SDFQTLAAEILKPGNS 65

  Fly   173 VIKYKKHLEGADLTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEAVDMQNAKDTAAK-INAWVM 236
            .:          |..|.:: |..:....::.|.|..|.||.|..::|:...|.....| ||:||.
Mouse    66 YV----------LKTANRI-YGEKTYPFHNKYLEDMKTYFGAEPQSVNFVEASGQIRKEINSWVG 119

  Fly   237 DTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTS--PYDFQHTNGR-ISKVAMMF 298
            ..|..||.:|:....||.:|:.:||||:||:|.|||:|:...|:  |:....|..: :..::|..
Mouse   120 SQTGGKIPNLLPDDSVDTKTKMVLVNALYFKGTWEHQFSVKSTTERPFRVNKTTSKPVQMMSMKQ 184

  Fly   299 NDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLSRPEFDLNRVAHRLRRQS 363
            :..|:.:.||..:|   |:|.|::...|:|:|||....||.::.:.::..:.|....|..:....
Mouse   185 SLQVFHIEELQTIG---LQLHYQNRDLSLLLLLPEAIDGLEQLERAITYEKLDKWTSADMMDTYE 246

  Fly   364 VAVRLPKFQFEFEQDMTEPLK 384
            |.:.||||:.|...|:...|:
Mouse   247 VQLYLPKFKMEESYDLKSALR 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 78/281 (28%)
Serpinb10XP_006529660.1 serpin 1..>277 CDD:393296 78/281 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.