DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpina3f

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001028507.2 Gene:Serpina3f / 238393 MGIID:2182838 Length:445 Species:Mus musculus


Alignment Length:407 Identity:108/407 - (26%)
Similarity:180/407 - (44%) Gaps:87/407 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 FSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMA---VAQDFE 171
            |:..|:||::.....:||||||||:...|||:...:...|.:|:.:..:|:.....   :.|.|.
Mouse    44 FAFSLYKELVLKNPDENVVFSPFSICTALALLSLGAKSNTLKEILEGLKFNLTETPEPDIHQGFR 108

  Fly   172 ------------------SVIKYKKHLEGADLTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEA 218
                              |.:..:|||:                  :...:.|.|:..:.|....
Mouse   109 YLLDLLSQPGNQVQISTGSALFIEKHLQ------------------ILAEFKEKARALYQAEAFT 155

  Fly   219 VDMQNAKDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYD 283
            .|.|...:....||.:|.:.|:.||::|:  :|:|.:|..:|||.:||:|:||..|...||...:
Mouse   156 ADFQQPLEATKLINDYVSNHTQGKIKELI--SDLDKRTLMVLVNYIYFKGKWEMPFDPDDTCKSE 218

  Fly   284 FQHTNGRISKVAMM---------FNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLG 339
            |.....|..||.||         |.|:        ||..|.:||.|..:|::|.| ||::    |
Mouse   219 FYLDENRSVKVPMMKINNLTTPYFRDE--------ELSCTVVELKYTGNASAMFI-LPDQ----G 270

  Fly   340 KMLQQLSRPEFDLNRVAHRLRRQSVAVR------LPKFQFEFEQDMTEPLKNLGVHQMFTPNSQV 398
            || ||:   |..|.....|..:.|:..|      ||||....:..:...|..||:.::|:..:.:
Mouse   271 KM-QQV---EASLQPETLRNWKDSLKPRLINELCLPKFSISTDYSLEHILPELGIRELFSTQADL 331

  Fly   399 TKLM-DQPVRVSKILQKAYINVGEAGTEASAAS-YAKF-----VPLSLPPKPTEFVANRPFVFAV 456
            :.:. .:.:|.|:::.||.::|.|.||||:|.: |...     |..|:     :...:|||:..:
Mouse   332 SAITGTKDLRTSQVVHKAVLDVAETGTEAAAGTGYQNLQCCQGVIYSM-----KIYFDRPFLMII 391

  Fly   457 RTPAS--VLFIGHVEYP 471
            ....:  .||:..|..|
Mouse   392 SDTNTHIALFMAKVSNP 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 106/402 (26%)
Serpina3fNP_001028507.2 alpha-1-antitrypsin_like 40..405 CDD:239011 106/402 (26%)
RCL 357..382 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.