DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpinb9

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_033282.1 Gene:Serpinb9 / 20723 MGIID:106603 Length:374 Species:Mus musculus


Alignment Length:369 Identity:106/369 - (28%)
Similarity:179/369 - (48%) Gaps:12/369 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 FSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVAQDFESVI 174
            |:..|.|.:.:|...:||.:||.|:.:.||::...:.|:|..::.:|...:|.. .:.|.|:.::
Mouse    11 FAIHLLKMLCQSNPSKNVCYSPASISSALAMVLLGAKGQTAVQISQALGLNKEE-GIHQGFQLLL 74

  Fly   175 -KYKKHLEGADLTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEAVDMQNAKDTAAKINAWVMDT 238
             |..|......|.:|.:::.::....:....:....||.|...:....:.|:.:...||.||...
Mouse    75 RKLNKPDRKYSLRVANRLFADKTCEVLQTFKESSLHFYDSEMEQLSFAEEAEVSRQHINTWVSKQ 139

  Fly   239 TRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGRISKVAMMFNDDVY 303
            |..||.:|::...||.:|:.:|:||:||:|:|...|....|....|:........|.||..:|.|
Mouse   140 TEGKIPELLSGGSVDSETRLVLINALYFKGKWHQPFNKEYTMDMPFKINKDEKRPVQMMCREDTY 204

  Fly   304 GLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLSRPEFDLNRVAHRLRRQSVAVRL 368
            .||.:.|:.|..|.:.|:....|:::|||:|...|.|:...|:..:......|..::...|.|.|
Mouse   205 NLAYVKEVQAQVLVMPYEGMELSLVVLLPDEGVDLSKVENNLTFEKLTAWMEADFMKSTDVEVFL 269

  Fly   369 PKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLMDQPVR---VSKILQKAYINVGEAGTEASAAS 430
            |||:.:.:.||....:.|||..:|..:......| .|.|   |||.:.::.:.:.|.||||:|||
Mouse   270 PKFKLQEDYDMESLFQRLGVVDVFQEDKADLSGM-SPERNLCVSKFVHQSVVEINEEGTEAAAAS 333

  Fly   431 -YAKFVPLSLPPKPTEFVANRPFVFAVR--TPASVLFIGHVEYP 471
             ..:|...|..|   .|.|:.||:|.:|  ...|:||.|....|
Mouse   334 AIIEFCCASSVP---TFCADHPFLFFIRHNKANSILFCGRFSSP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 105/364 (29%)
Serpinb9NP_033282.1 serpin 1..374 CDD:393296 105/367 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.