DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpina3m

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_033279.2 Gene:Serpina3m / 20717 MGIID:98378 Length:418 Species:Mus musculus


Alignment Length:386 Identity:105/386 - (27%)
Similarity:188/386 - (48%) Gaps:46/386 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 FSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVA---QDFE 171
            |:..|:|::......:|:||||.|:.|.|||:...:.|.|..|:.:..:|:....:.|   |.|.
Mouse    54 FAFSLYKKMALKNPDKNIVFSPLSISAALALVSLGAKGNTLEEILEGLKFNLTETSEADIHQGFG 118

  Fly   172 SVIKYKKHLEGAD-LTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEA--VDMQNAKDTAAKINA 233
            .:::.....|..| :.:...::..::|..:...:::....|   .|||  .|.|...:....||.
Mouse   119 HLLQRLSQPEDQDQINIGNAMFIEKDLQILAEFHEKTRALY---QTEAFTADFQQPTEATKLIND 180

  Fly   234 WVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGRISKVAMM- 297
            :|.:.|:..|:.|:  :::|.:|..:|||.:||:|:|:..|...||...:|.....|..||.|| 
Mouse   181 YVSNQTQGMIKKLI--SELDDRTLMVLVNYIYFKGKWKISFDPQDTFESEFYLDEKRSVKVPMMK 243

  Fly   298 --------FNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLS---RPEFD 351
                    |.|:        ||..:.|||.|..:| |.|.:||::    |:| ||:.   :|| .
Mouse   244 MKFLTTRHFRDE--------ELSCSVLELKYTGNA-SALFILPDQ----GRM-QQVEASLQPE-T 293

  Fly   352 LNRVAHRLRRQSVA-VRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLM-DQPVRVSKILQK 414
            |.:....|:.:.:. :.||||....:.::.:.|..||:.::|:..:.::.:. .:.:.||:::.|
Mouse   294 LRKWWKSLKTRKIGELYLPKFSISTDYNLKDILPELGIKEIFSKQADLSGITGTKDLSVSQVVHK 358

  Fly   415 AYINVGEAGTEASAAS--YAKFVPLSLPPKPTEFVANRPFVFAVRTPA--SVLFIGHVEYP 471
            |.::|.|.||||:||:  ...|....|.....:|  ||||:..:....  :.||:..|..|
Mouse   359 AVLDVAETGTEAAAATGFIFGFRSRRLQTMTVQF--NRPFLMVISHTGVQTTLFMAKVTNP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 103/381 (27%)
Serpina3mNP_033279.2 SERPIN 56..417 CDD:214513 103/382 (27%)
RCL 367..392 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.