DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpina3n

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_033278.2 Gene:Serpina3n / 20716 MGIID:105045 Length:418 Species:Mus musculus


Alignment Length:377 Identity:108/377 - (28%)
Similarity:193/377 - (51%) Gaps:28/377 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 FSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVA---QDFE 171
            |:..|:||::.....:|:||||.|:.|.||::...:.|.|..|:.:..:|:....:.|   |.|.
Mouse    54 FAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFG 118

  Fly   172 SVI-KYKKHLEGADLTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEAVDMQNAKDTAAKINAWV 235
            .:: :..:..:...::..:.::..:. ..:...:.|.|:..:.|.....|.|..:.....||.:|
Mouse   119 HLLQRLNQPKDQVQISTGSALFIEKR-QQILTEFQEKARALYQAEAFTADFQQPRQAKKLINDYV 182

  Fly   236 MDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGRISKVAMMFND 300
            ...|:..|::||  :|:|.:|..:|||.:||:.:|:..|..:||...:|.....|...|.||..:
Mouse   183 RKQTQGMIKELV--SDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSME 245

  Fly   301 DV---YGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLS---RPEFDLNRVAHRL 359
            |:   |...|  ||..|.:||.|..:|::|.| ||::    ||| ||:.   :|| .|.:..:.|
Mouse   246 DLTTPYFRDE--ELFCTVVELKYTGNASAMFI-LPDQ----GKM-QQVEASLQPE-TLRKWKNSL 301

  Fly   360 RRQSV-AVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLM-DQPVRVSKILQKAYINVGEA 422
            :.:.: .:.||||....:..:.:.|..||:.::|:..:.::.:. .:.:|||:::.||.::|.|.
Mouse   302 KPRMIDELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAET 366

  Fly   423 GTEASAASYAKFVPLSLPPKPTEFVANRPF---VFAVRTPASVLFIGHVEYP 471
            ||||:||:..||||:|....|.....||||   :|...|..:. ||..:..|
Mouse   367 GTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAP-FIAKIANP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 107/372 (29%)
Serpina3nNP_033278.2 serpinA3_A1AC 37..418 CDD:381019 108/377 (29%)
RCL 367..392 12/24 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.