DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpinb9e

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_035586.1 Gene:Serpinb9e / 20710 MGIID:894672 Length:377 Species:Mus musculus


Alignment Length:379 Identity:106/379 - (27%)
Similarity:179/379 - (47%) Gaps:29/379 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 FSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVAQDFESVI 174
            |:..|.|.:.:....:||.:||.|:.:.||::...:.|.|..::.:|...:.:. .|.|.|:.::
Mouse    11 FAIHLLKVLCQDNPSENVCYSPMSISSALAMVLLGAKGDTAVQICQALHLNPDE-DVHQGFQLLL 74

  Fly   175 K--YKKHLEGADLTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEAVDMQNAKDTAAKINAWVMD 237
            .  .|.:.:...||:|.:::.......:........|||.|...:....:.|:::...||.||..
Mouse    75 HNLNKPNNQKYCLTMANRLFVENTCELLPTFKKSCLKFYHSEIEQLSFAEAAEESRQHINMWVSK 139

  Fly   238 TTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGRISKVAMMFNDDV 302
            .|:.||.||::...||.||:.:|.||:||||.|...|....|....|:........|.||:.:|.
Mouse   140 QTKGKIPDLLSEDSVDSQTRLILANALYFQGTWCKFFEKDSTKEVPFKINKKETRPVQMMWQEDT 204

  Fly   303 YGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQL--------SRPEFDLNRVAHRL 359
            :..|.:.|:.|..|.:.|:....:.::|||::...:.|:...|        ::|||        :
Mouse   205 FFHAYVKEIQAQVLVMPYEGIDLNFVVLLPDQGVDISKVENNLTFEKLTAWTKPEF--------M 261

  Fly   360 RRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTP-----NSQVTKLMDQPVRVSKILQKAYINV 419
            .|..:.|.||||:.:.:.||...|::||:..:|..     :...||   :.:.:||.:.|..:.|
Mouse   262 NRTELHVYLPKFKLQEDYDMNSLLQHLGILDVFNGSKADFSGMSTK---ENLCLSKFVHKCVVEV 323

  Fly   420 GEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAV--RTPASVLFIGHVEYP 471
            .|.||||.|||..|.:.....|.|..|.|:.||:|.:  .|..|:||.|....|
Mouse   324 NEEGTEAVAASAGKIILFCDGPDPEVFCADHPFLFFIMHSTTNSILFCGRFSSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 105/374 (28%)
Serpinb9eNP_035586.1 SERPIN 4..377 CDD:294093 105/377 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.