DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpina1e

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_033273.1 Gene:Serpina1e / 20704 MGIID:891967 Length:413 Species:Mus musculus


Alignment Length:410 Identity:106/410 - (25%)
Similarity:195/410 - (47%) Gaps:42/410 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 DVVAVDLTKREPVTPPPNRPPPVFSYMDRFSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGAS 145
            ||...| |.::..:|..:.   :.:.:..|:..|::|::...:..|:.|||.|:....|::...|
Mouse    26 DVQETD-TSQKDQSPASHE---IATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGS 86

  Fly   146 DGKTFRELQKAGEFSKNAMAVAQDFESVIKYKKHL------EGADLTLAT--KVYYNRELGGVNH 202
            .|.|..::.:..:|:....:.|....|.    :||      ..::|.|:|  .::.|.:|..|..
Mouse    87 KGDTHTQILEGLQFNLTQTSEADIHNSF----QHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEK 147

  Fly   203 SYDEYAKFYFSAGTEAVDMQNAKDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQ 267
            ..:| ||.::.|...:|:...:::....||.:|...|:.||.:.|...:.|  |..:|.|.:.|:
Mouse   148 FLEE-AKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIVEAVKKLEQD--TVFVLANYILFK 209

  Fly   268 GRWEHEFATMDTSPYDFQHTNGRISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLP 332
            |:|:..|...:|...:|........||.||....:..:.....|.:..|.:.|..:||: :.|||
Mouse   210 GKWKKPFDPENTKQAEFHVDESTTVKVPMMTLSGMLDVHHCSTLSSWVLLMDYAGNATA-VFLLP 273

  Fly   333 NETTGLGKM--LQQLSRPE----FDLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQM 391
            ::    |||  |:|....|    |.|||     ||:...:.:|:.......::...:..||:.::
Mouse   274 DD----GKMQHLEQTLNKELISKFLLNR-----RRRLAQIHIPRLSISGNYNLETLMSPLGITRI 329

  Fly   392 FTPNSQVTKLMDQ--PVRVSKILQKAYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVF 454
            |...:.::.:.::  |:::|:.:.||.:.:.|.||||:||:..:...||:|| ...|  ||||:|
Mouse   330 FNSGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAATVLQGGFLSMPP-ILHF--NRPFLF 391

  Fly   455 AV--RTPASVLFIGHVEYPT 472
            .:  ....|.||:|.|..||
Mouse   392 IIFEEHSQSPLFVGKVVDPT 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 98/377 (26%)
Serpina1eNP_033273.1 SERPIN 53..410 CDD:214513 98/376 (26%)
RCL 368..387 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.