DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpina1c

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_033271.1 Gene:Serpina1c / 20702 MGIID:891969 Length:413 Species:Mus musculus


Alignment Length:407 Identity:104/407 - (25%)
Similarity:195/407 - (47%) Gaps:36/407 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 DVVAVDLTKREPVTPPPNRPPPVFSYMDRFSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGAS 145
            ||...| |.::..:|..:.   :.:.:..|:..|::|::...:..|:.|||.|:....|::...|
Mouse    26 DVQETD-TSQKDQSPASHE---IATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGS 86

  Fly   146 DGKTFRELQKAGEFSKNAMAVAQDFESVI-KYKKHL------EGADLTLAT--KVYYNRELGGVN 201
            .|.|..::.:..:|:     :.|..|:.| |..:||      ..::|.|:|  .::.|.:|..|.
Mouse    87 KGDTHTQILEGLQFN-----LTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVE 146

  Fly   202 HSYDEYAKFYFSAGTEAVDMQNAKDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYF 266
            ...:| ||.::.|...:|:...:::....||.:|...|:.||.:.|...|.|  |...|.|.:.|
Mouse   147 KFLEE-AKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQD--TVFALANYILF 208

  Fly   267 QGRWEHEFATMDTSPYDFQHTNGRISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILL 331
            :|:|:..|...:|...:|........||.||....:..:.....|.:..|.:.|..:||: :.||
Mouse   209 KGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLDVHHCSTLSSWVLLMDYAGNATA-VFLL 272

  Fly   332 PNETTGLGKM--LQQLSRPEFDLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTP 394
            |::    |||  |:|....|. :::...:..|:...:..|:.....|.::...:..||:.::|..
Mouse   273 PDD----GKMQHLEQTLSKEL-ISKFLLKRPRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNN 332

  Fly   395 NSQVTKLMDQ--PVRVSKILQKAYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAV- 456
            .:.::.:.::  |:::|:.:.||.:.:.|.||||:||:....||.|:|| ...|  :.||:|.: 
Mouse   333 GADLSGITEENAPLKLSQAVHKAVLTMDETGTEAAAATVLLAVPYSMPP-IVRF--DHPFLFIIF 394

  Fly   457 -RTPASVLFIGHVEYPT 472
             ....|.||:|.|..||
Mouse   395 EEHTQSPLFVGKVVDPT 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 96/374 (26%)
Serpina1cNP_033271.1 SERPIN 53..410 CDD:214513 96/373 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.