DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpina1a

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001239498.1 Gene:Serpina1a / 20700 MGIID:891971 Length:436 Species:Mus musculus


Alignment Length:411 Identity:107/411 - (26%)
Similarity:198/411 - (48%) Gaps:44/411 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 DVVAVDLTKREPVTPPPNRPPPVFSYMDRFSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGAS 145
            ||...| |.::..:|..:.   :.:.:..|:..|::|::...:..|:.|||.|:....|::...|
Mouse    49 DVQETD-TSQKDQSPASHE---IATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGS 109

  Fly   146 DGKTFRELQKAGEFSKNAMAVAQDFESVI-KYKKHL------EGADLTLAT--KVYYNRELGGVN 201
            .|.|..::.:..:|:     :.|..|:.| |..:||      ..::|.|:|  .::.|.:|..|.
Mouse   110 KGDTHTQILEGLQFN-----LTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVE 169

  Fly   202 HSYDEYAKFYFSAGTEAVDMQNAKDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYF 266
            ...:| ||.::.|...:|:...:::....||.:|...|:.||.:.|...|.|  |...|.|.:.|
Mouse   170 KFLEE-AKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQD--TVFALANYILF 231

  Fly   267 QGRWEHEFATMDTSPYDFQHTNGRISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILL 331
            :|:|:..|...:|...:|........||.||....:..:.....|.:..|.:.|..:||: :.||
Mouse   232 KGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLHVHHCSTLSSWVLLMDYAGNATA-VFLL 295

  Fly   332 PNETTGLGKML---QQLSR---PEFDLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQ 390
            |::    |||.   |.||:   .:|.|||     ||:...:..|:.....|.::...:..||:.:
Mouse   296 PDD----GKMQHLEQTLSKELISKFLLNR-----RRRLAQIHFPRLSISGEYNLKTLMSPLGITR 351

  Fly   391 MFTPNSQVTKLMDQ--PVRVSKILQKAYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFV 453
            :|...:.::.:.::  |:::|:.:.||.:.:.|.||||:|.:..:.||:|:|| ...|  :.||:
Mouse   352 IFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMSMPP-ILRF--DHPFL 413

  Fly   454 FAV--RTPASVLFIGHVEYPT 472
            |.:  ....|.:|:|.|..||
Mouse   414 FIIFEEHTQSPIFLGKVVDPT 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 99/378 (26%)
Serpina1aNP_001239498.1 SERPIN 76..433 CDD:214513 99/377 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.