DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpinb3a

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_033152.3 Gene:Serpinb3a / 20248 MGIID:3573933 Length:387 Species:Mus musculus


Alignment Length:382 Identity:110/382 - (28%)
Similarity:194/382 - (50%) Gaps:23/382 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 RFSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNA------MAVA 167
            :|:.||::::  .:|..|:.:||.|:...||::...:.|.|.::::|..:|::..      .|..
Mouse    10 KFTLELYRQL--RESDNNIFYSPISMMTALAMLQLGAKGNTEKQIEKVLQFNETTKKTTEKSAHC 72

  Fly   168 QDFESV--------IKYKKHLEGADLTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEAVDMQN- 223
            .|.|:|        .:..|..:..||..|..:|..:....| .::.|..|.|:.|..|::|.:: 
Mouse    73 HDEENVHEQFQKLMTQLNKSNDAYDLKAANSIYGAKGFPFV-QTFLEDIKEYYQANVESLDFEHA 136

  Fly   224 AKDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTN 288
            |:::..|||:||...|..||:||.....::..|..:|||||||:|:|.|:|....|:...|....
Mouse   137 AEESEKKINSWVESQTNGKIKDLFPNGSLNRSTIMVLVNAVYFKGQWNHKFDEKHTTEEKFWLNK 201

  Fly   289 GRISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLSRPEFDLN 353
            .....|.||..:..:....|.::.|..:|:.||....||::|||.|..||.::.:||:..:....
Mouse   202 NTSKPVQMMKQNIEFNFMFLEDVQAKIVEIPYKGKELSMIVLLPVEINGLKQLEEQLTADKLLEW 266

  Fly   354 RVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLMD--QPVRVSKILQKAY 416
            ..|..:....:.:.||:|:.:.:.|:..||:::|:...|.|.......|.  |.:.|||:|.|::
Mouse   267 TRAENMHMTELYLSLPRFKVDEKYDLPIPLEHMGMVDAFDPQKADFSGMSSTQGLVVSKVLHKSF 331

  Fly   417 INVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAV--RTPASVLFIGHVEYP 471
            :.|.|.||||:||:..: |.|:......:|..:.||:|.:  |...|:||.|.:..|
Mouse   332 VEVNEEGTEAAAATGVE-VSLTSAQIAEDFCCDHPFLFFIIHRKTNSILFFGRISSP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 109/377 (29%)
Serpinb3aNP_033152.3 SERPIN 5..387 CDD:294093 109/380 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.