DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpind1

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001317976.1 Gene:Serpind1 / 15160 MGIID:96051 Length:478 Species:Mus musculus


Alignment Length:396 Identity:101/396 - (25%)
Similarity:184/396 - (46%) Gaps:64/396 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 RFSSELFKEIIKSQ--SQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVAQDFE 171
            :|:..|:: ::|.|  :..|:..:|..:...:.:|.....|:|..|:                 .
Mouse   111 KFAFNLYR-VLKDQATTSDNLFIAPVGISTAMGMISLGLRGETHEEV-----------------H 157

  Fly   172 SVIKYKKHLEGADLTLATKVY----------YNRELG----GVNHSYDE------------YAKF 210
            ||:.::..:..:.....|.::          :.|..|    .||..|.:            ..:|
Mouse   158 SVLHFRDFVNASSKYEVTTIHNLFRKLTHRLFRRNFGYTLRSVNGLYIQKQFPIREDFKAAMREF 222

  Fly   211 YFSAGTEAVDMQNAKDTA--AKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHE 273
            ||:...||    |..|.|  :|.|..::..|:..|::.:  .::||.||.|::|.:||:|.|.::
Mouse   223 YFAEAQEA----NFPDPAFISKANNHILKLTKGLIKEAL--ENIDPATQMLILNCIYFKGTWVNK 281

  Fly   274 FATMDTSPYDFQHTNGRISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGL 338
            |....|..::|:.....:.||:||.....:..|...||....|:|.|. ...||||::|.:.:|:
Mouse   282 FPVEMTHNHNFRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEYV-GGISMLIVVPRKLSGM 345

  Fly   339 GKMLQQLSRPEFDLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLMD 403
            ..:..||: |:. :.|....:..::..|.||||:.|...::.|.||::|:.::|..|..::.:.|
Mouse   346 KTLEAQLT-PQV-VERWQKSMTNRTREVLLPKFKLEKNYNLVEVLKSMGITKLFNKNGNMSGISD 408

  Fly   404 QPVRVSKILQKAYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAV---RTPASVLFI 465
            |.:.:.....::.|.|.|.||:|:|.:...|:|||   ....|..:|||:|.|   || :.:||:
Mouse   409 QRIAIDLFKHQSTITVNEEGTQAAAVTTVGFMPLS---TQVRFTVDRPFLFLVYEHRT-SCLLFM 469

  Fly   466 GHVEYP 471
            |.|..|
Mouse   470 GKVTNP 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 99/391 (25%)
Serpind1NP_001317976.1 HCII 43..476 CDD:239002 101/396 (26%)
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 54..78
Glycosaminoglycan-binding site. /evidence=ECO:0000250 171..191 1/19 (5%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.