DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and Serpina6

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_031644.1 Gene:Serpina6 / 12401 MGIID:88278 Length:397 Species:Mus musculus


Alignment Length:395 Identity:91/395 - (23%)
Similarity:177/395 - (44%) Gaps:46/395 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 WTQNNQEAISDVVAVDLTKREPVTPPPNRPPPVFSYMDRFSSELFKEIIKSQSQQNVVFSPFSVH 135
            ||   .:|::|   .|.:....:.|         :.:| |:..|:|.::...|.:|.:.||.|:.
Mouse    18 WT---TQAVTD---EDSSSHRDLAP---------TNVD-FAFNLYKRLVALNSDKNTLISPVSIS 66

  Fly   136 ALLALIYGASDGKTFRELQKAGEFSKNAMAVAQDFESVIKYKKHL-----EGADLTLATKVYYNR 195
            ..||::..::.|.| :.|:..| |:.:.|:.|:..:. .:|...|     .|.::.:...::..:
Mouse    67 MALAMLSLSTRGST-QYLENLG-FNMSKMSEAEIHQG-FQYLNSLLQQSDTGLEMNMGNVMFLLQ 128

  Fly   196 ELGGVNHSYDEYAKFYFSAGTEAVDMQNAKDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALL 260
            .| .:..|:....|.|:.:....:..::......:||..|.:.|:.||..:|  :|:|.....:|
Mouse   129 NL-KLKDSFLADTKHYYESEALTIPSKDWTKAGEQINNHVKNKTQGKIEHVV--SDLDSSATLIL 190

  Fly   261 VNAVYFQGRWEHEFATMDTSPYDFQHTNGRISKVAMMFNDDVYGLAELPELGATALELAYKDSAT 325
            :|.::.:|.|:..|:..:|...||........||.||.............:....:::.|..:.|
Mouse   191 INYIFLKGIWKLPFSPENTREEDFYVNETSTVKVPMMVQSGNISYFRDSAIPCQMVQMNYVGNGT 255

  Fly   326 SMLILLPNETTGLGKM---LQQLSRPEFDLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLG 387
            : .|:||::    |:|   :..|:|...|  |....:..:.:.:.:|||......|:.:.|.::|
Mouse   256 T-FIILPDQ----GQMDTVVAALNRDTID--RWGKLMIPRQMNLYIPKFSMSDTYDLQDVLADVG 313

  Fly   388 VHQMFTPNS---QVTKLMDQPVRVSKILQKAYINVGEAGTEASAASYAKFVPLSLPPKPTEFVAN 449
            :..:||..|   ..||  |.|:.:: :|.||.:.:.| |....||:...  |:.||.:......|
Mouse   314 IKDLFTNQSDFADTTK--DTPLTLT-VLHKAMLQLDE-GNVLPAATNGP--PVHLPSESFTLKYN 372

  Fly   450 RPFVF 454
            |||:|
Mouse   373 RPFIF 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 85/358 (24%)
Serpina6NP_031644.1 SERPIN 43..396 CDD:214513 83/354 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.