DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and LOC100909605

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_006240581.2 Gene:LOC100909605 / 100909605 RGDID:6502633 Length:410 Species:Rattus norvegicus


Alignment Length:383 Identity:105/383 - (27%)
Similarity:191/383 - (49%) Gaps:40/383 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 FSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVA---QDFE 171
            |:..|:||::.....:|:|||.||:...|.|:...:...|.:|:.:..:|:......|   |.:|
  Rat    44 FAFSLYKELVLKNPDKNIVFSSFSISTALVLLSLGAKNNTLKEILEGLKFNLTETPEAEIHQGYE 108

  Fly   172 SVIKYKKHLEGADLTLAT--KVYYNRELGGVNHSYDEYAKFYFSAGTEAVDMQNAKDTAAKINAW 234
            .::: :.:|.|..:.::|  .::..:.| .:...:.|.|:..:.|...:.|.|...:....||.:
  Rat   109 HLLQ-RLNLPGDQVQISTGSALFIKKHL-QILAEFQEKARALYQAEAFSTDFQQPHEAKKLINDY 171

  Fly   235 VMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGRISKVAMM-- 297
            |...|:.||::|::.  :|.:|..:|||.:||:|:|:..|...||...:|.....:..||.||  
  Rat   172 VRKQTQGKIKELISV--LDKKTSMVLVNYIYFKGKWKMPFDPHDTFQSEFYLDEKKSVKVPMMKI 234

  Fly   298 -------FNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLS---RPEFDL 352
                   |.|:        ||..:.|||.|..:| |.|.:||::    |:| ||:.   :|| .|
  Rat   235 EKLTTPYFRDE--------ELSCSVLELKYTGNA-SALFILPDQ----GRM-QQVEASLQPE-TL 284

  Fly   353 NRVAHRLR-RQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLMD-QPVRVSKILQKA 415
            .|....|| |:...:|:|||....:..:.:.|..||:.::|:..:.::::.. :.:.||:::.||
  Rat   285 RRWKDTLRPRRIDELRMPKFSISTDMRLGDILPELGIREVFSQQADLSRITGAKDLSVSQVVHKA 349

  Fly   416 YINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAVRTPAS--VLFIGHVEYP 471
            .::|.|.||||:||:..|.:|:...........||||:..:....:  .||:..|..|
  Rat   350 VLDVTETGTEAAAATGVKIIPMCAKFYYVTMYFNRPFLMIISDTNTHIALFMAKVTNP 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 103/378 (27%)
LOC100909605XP_006240581.2 alpha-1-antitrypsin_like 41..404 CDD:239011 103/378 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.