DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nec and serpina10b

DIOPT Version :9

Sequence 1:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_009291625.1 Gene:serpina10b / 100003661 ZFINID:ZDB-GENE-100716-5 Length:395 Species:Danio rerio


Alignment Length:373 Identity:109/373 - (29%)
Similarity:177/373 - (47%) Gaps:27/373 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 FSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKA-------GEFSKNAMAVA 167
            |:..|::: |.|...:||||||.||....:.:..|:.|.|..|:.|.       |..|:....:.
Zfish    38 FAINLYRK-ISSLHDRNVVFSPLSVSTCFSALLLAAQGSTRTEILKGLNLEALDGGDSRRVPELF 101

  Fly   168 QDFESVIKYKKHLEGADLTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEAVDMQNAKDTAAKIN 232
            |.....|..:.. :|..|.|....:       :..::.:..:.:|:|....||........:.||
Zfish   102 QQLHQNISLQME-QGTALFLDQHFH-------LQTNFSQQIQRFFNAEVLRVDFSKPAVCRSLIN 158

  Fly   233 AWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGRISKVAMM 297
            .:|...|..|:.:::  ..|:|.||.||:|.::::|.||..|...:|....|......|.:|.||
Zfish   159 EFVSRKTGRKVLEML--ESVEPLTQMLLLNTIFYKGDWERPFNPNNTEKSRFYVDKYNIVQVPMM 221

  Fly   298 FNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLSRPEFDLNRVAHRLRRQ 362
            ..::.:.:.|..:|.|..|.|.|:..| |||||||:.......:..::|...  |:.....:||.
Zfish   222 MLEEKFSVVEDRDLRARVLRLPYRGGA-SMLILLPSADADYTAIEDEISAER--LHGWIKNMRRM 283

  Fly   363 SVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKL-MDQPVRVSKILQKAYINVGEAGTEA 426
            .:.|.||:|:.:....|.|.|..||:..:|..::.:|.| .|..::||::|.||.|.|.|.||.|
Zfish   284 KMEVHLPRFRMDQSYHMHELLPQLGISSVFQDSADLTGLSRDAHLKVSQVLHKAVIEVYEQGTSA 348

  Fly   427 SAASYAKFVPLSLPPKPTEFVANRPFVFAV--RTPASVLFIGHVEYPT 472
            ::::.......||   |..|:.||||.|.:  ...||:||:|.|..||
Zfish   349 ASSTSVGITAYSL---PDTFIINRPFFFFLYHEETASLLFMGRVIDPT 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
necNP_524851.1 SERPIN 108..468 CDD:238101 106/367 (29%)
serpina10bXP_009291625.1 Serpin 35..392 CDD:278507 107/370 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.