DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lds and F19B2.5

DIOPT Version :9

Sequence 1:NP_524850.2 Gene:lds / 45894 FlyBaseID:FBgn0002542 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_001366639.1 Gene:F19B2.5 / 180319 WormBaseID:WBGene00008944 Length:144 Species:Caenorhabditis elegans


Alignment Length:157 Identity:38/157 - (24%)
Similarity:64/157 - (40%) Gaps:31/157 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   569 LRDYDIVVTTYQIVAREHKSLSAVFGVKWRRIILDEAHVVRNHKSQSSLAVCDLRGKYRWALTGT 633
            |..:.:||||:..: :...:...:..:.:.|||:.:|:.:.|..:|...|:..|...|||.|||.
 Worm    10 LAKHSVVVTTFDTI-KTLMNFQTLQKISFERIIIYDAYPIDNTDTQRYKALRQLDATYRWVLTGN 73

  Fly   634 PIQNKELDVYALLKFLRCSPFDDLHTWK---------KWIDNKSAGGQNRLNLLMKSLMLRRTKA 689
            .:|..      |..||:...:.|...|.         |..|.|:...:...||| ||:.|:    
 Worm    74 LLQQN------LANFLKLGEYGDDQLWDTQICPILEGKQCDEKTELSKKIENLL-KSVELK---- 127

  Fly   690 QLQSDGKLNSLPNKELRLIEISLDKEE 716
                      .|.:..|.:|:..|..:
 Worm   128 ----------FPLENYREMEVGADDSQ 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ldsNP_524850.2 SNF2_N 442..805 CDD:278600 38/157 (24%)
DEXDc 459..634 CDD:238005 19/64 (30%)
HELICc 885..1014 CDD:238034
F19B2.5NP_001366639.1 DEAD-like_helicase_N <2..127 CDD:421690 33/124 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3486
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.